Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XA94

Protein Details
Accession A0A1Y1XA94    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-43AAKTEVAEKKTRKKRTKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
5-40AKPREEKVSKRAAKTEVAEKKTRKKRTKKDPNAPKR
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKTAKPREEKVSKRAAKTEVAEKKTRKKRTKKDPNAPKRALSAFMFFSQEWREKVKTENPDVSFGQIGKILGEKWNKMDEDEKKPFATKAEQDKKRYEVAKAAYEKNGSGNSEEDEESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.68
3 0.62
4 0.57
5 0.54
6 0.57
7 0.55
8 0.54
9 0.57
10 0.57
11 0.65
12 0.69
13 0.76
14 0.76
15 0.78
16 0.83
17 0.86
18 0.92
19 0.92
20 0.93
21 0.94
22 0.95
23 0.94
24 0.86
25 0.77
26 0.7
27 0.6
28 0.53
29 0.43
30 0.34
31 0.26
32 0.24
33 0.24
34 0.18
35 0.19
36 0.18
37 0.2
38 0.18
39 0.2
40 0.2
41 0.19
42 0.23
43 0.28
44 0.3
45 0.32
46 0.37
47 0.34
48 0.37
49 0.36
50 0.33
51 0.27
52 0.22
53 0.18
54 0.12
55 0.11
56 0.08
57 0.08
58 0.07
59 0.12
60 0.14
61 0.15
62 0.16
63 0.2
64 0.2
65 0.2
66 0.27
67 0.29
68 0.36
69 0.41
70 0.41
71 0.39
72 0.4
73 0.39
74 0.35
75 0.35
76 0.32
77 0.38
78 0.46
79 0.52
80 0.56
81 0.61
82 0.61
83 0.62
84 0.57
85 0.49
86 0.46
87 0.43
88 0.47
89 0.47
90 0.47
91 0.44
92 0.43
93 0.41
94 0.37
95 0.36
96 0.28
97 0.25
98 0.23
99 0.21
100 0.23