Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YRQ0

Protein Details
Accession A0A1Y1YRQ0    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
116-136LWFRHAHKCHVHHKPKSLKKRBasic
NLS Segment(s)
PositionSequence
129-136KPKSLKKR
Subcellular Location(s) mito 10, cyto 9, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028012  Rua1_C  
Pfam View protein in Pfam  
PF14616  Rua1_C  
Amino Acid Sequences MPSFDLAPADIGNPDARPRRQKARFDGDLYTPQWVRYSGQTKEGFCQHCKPGKWLQLKNSAYWYHVQFYHGISATSGHYYRAPLQMSTFENGIKGVCHQCREVVAVCHAKKKDMALWFRHAHKCHVHHKPKSLKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.29
4 0.37
5 0.44
6 0.53
7 0.61
8 0.69
9 0.72
10 0.74
11 0.74
12 0.69
13 0.66
14 0.6
15 0.57
16 0.48
17 0.44
18 0.34
19 0.29
20 0.26
21 0.24
22 0.21
23 0.22
24 0.28
25 0.25
26 0.33
27 0.36
28 0.36
29 0.38
30 0.44
31 0.4
32 0.36
33 0.4
34 0.38
35 0.41
36 0.41
37 0.43
38 0.44
39 0.48
40 0.55
41 0.54
42 0.53
43 0.57
44 0.57
45 0.53
46 0.5
47 0.42
48 0.35
49 0.33
50 0.28
51 0.2
52 0.19
53 0.19
54 0.15
55 0.15
56 0.16
57 0.13
58 0.12
59 0.09
60 0.1
61 0.1
62 0.11
63 0.1
64 0.09
65 0.09
66 0.11
67 0.13
68 0.16
69 0.16
70 0.15
71 0.16
72 0.19
73 0.2
74 0.2
75 0.18
76 0.14
77 0.13
78 0.13
79 0.12
80 0.09
81 0.1
82 0.15
83 0.17
84 0.2
85 0.2
86 0.21
87 0.22
88 0.25
89 0.24
90 0.2
91 0.23
92 0.3
93 0.31
94 0.37
95 0.36
96 0.35
97 0.34
98 0.35
99 0.35
100 0.35
101 0.4
102 0.39
103 0.46
104 0.5
105 0.56
106 0.61
107 0.57
108 0.55
109 0.57
110 0.59
111 0.61
112 0.67
113 0.7
114 0.7
115 0.78
116 0.83