Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X7B8

Protein Details
Accession A0A1Y1X7B8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-34KDAPAKPSSGGKKTKKKWSKGKVKDKANNLVVHydrophilic
NLS Segment(s)
PositionSequence
5-27APAKPSSGGKKTKKKWSKGKVKD
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences AKKDAPAKPSSGGKKTKKKWSKGKVKDKANNLVVFDQATLDKLMKEAPTYKLITTSVLVDRLRINGSLARVALRELETQGLIQKVSTHGSQLIYTRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.81
4 0.81
5 0.84
6 0.86
7 0.87
8 0.89
9 0.89
10 0.92
11 0.9
12 0.91
13 0.88
14 0.85
15 0.83
16 0.77
17 0.69
18 0.59
19 0.51
20 0.4
21 0.33
22 0.26
23 0.17
24 0.11
25 0.09
26 0.08
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.09
33 0.1
34 0.12
35 0.16
36 0.17
37 0.16
38 0.17
39 0.17
40 0.17
41 0.15
42 0.14
43 0.12
44 0.15
45 0.14
46 0.14
47 0.14
48 0.15
49 0.15
50 0.13
51 0.14
52 0.12
53 0.13
54 0.14
55 0.14
56 0.13
57 0.12
58 0.12
59 0.13
60 0.13
61 0.13
62 0.12
63 0.13
64 0.12
65 0.13
66 0.15
67 0.14
68 0.12
69 0.11
70 0.12
71 0.13
72 0.15
73 0.15
74 0.15
75 0.16
76 0.18
77 0.2