Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XVD6

Protein Details
Accession A0A1Y1XVD6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
119-145RSLKVFREKCRSHRIPKEFKKFLKREIBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019171  MIX23  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
Pfam View protein in Pfam  
PF09774  MIX23  
Amino Acid Sequences MAEEQTLNPNLCYNLTYFKDLMKGLRKIDDNIMLQMNTTNIHSEDSCATFFGQLSEAYKKREHTIQYCLKVMDEELAMKQKELHDDPDDYDVRDSIYTTESQRRMIHNELVVEDIVRDRSLKVFREKCRSHRIPKEFKKFLKREI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.24
5 0.24
6 0.27
7 0.27
8 0.32
9 0.32
10 0.34
11 0.33
12 0.38
13 0.39
14 0.38
15 0.41
16 0.41
17 0.34
18 0.33
19 0.32
20 0.26
21 0.24
22 0.22
23 0.18
24 0.12
25 0.11
26 0.1
27 0.08
28 0.1
29 0.1
30 0.11
31 0.12
32 0.13
33 0.13
34 0.12
35 0.12
36 0.11
37 0.11
38 0.1
39 0.09
40 0.08
41 0.1
42 0.16
43 0.17
44 0.2
45 0.22
46 0.22
47 0.24
48 0.28
49 0.3
50 0.28
51 0.35
52 0.39
53 0.4
54 0.4
55 0.38
56 0.33
57 0.28
58 0.25
59 0.17
60 0.1
61 0.07
62 0.07
63 0.11
64 0.11
65 0.1
66 0.12
67 0.12
68 0.16
69 0.16
70 0.19
71 0.18
72 0.19
73 0.2
74 0.24
75 0.24
76 0.2
77 0.19
78 0.15
79 0.14
80 0.13
81 0.12
82 0.08
83 0.09
84 0.1
85 0.12
86 0.2
87 0.2
88 0.24
89 0.27
90 0.29
91 0.32
92 0.35
93 0.36
94 0.31
95 0.31
96 0.28
97 0.26
98 0.23
99 0.18
100 0.15
101 0.12
102 0.1
103 0.09
104 0.09
105 0.09
106 0.14
107 0.19
108 0.24
109 0.33
110 0.41
111 0.49
112 0.59
113 0.65
114 0.68
115 0.74
116 0.77
117 0.77
118 0.8
119 0.82
120 0.83
121 0.87
122 0.9
123 0.88
124 0.88
125 0.89