Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XZ99

Protein Details
Accession A0A1Y1XZ99    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-45ELPNRYGQAHKPNNNRNKRKIDKSAIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
IPR039056  SPEC  
Gene Ontology GO:0005856  C:cytoskeleton  
GO:0005886  C:plasma membrane  
GO:0031267  F:small GTPase binding  
GO:0008360  P:regulation of cell shape  
GO:0035023  P:regulation of Rho protein signal transduction  
PROSITE View protein in PROSITE  
PS50108  CRIB  
Amino Acid Sequences MSFLKRCSCFGNNDDVLLSELPNRYGQAHKPNNNRNKRKIDKSAIGKPSNFQHTGHIGISELQSGVVDRVDPEKIKKQMAEIAAVLNFDDLITPELESIQRDNPTKEAPTHKAEVSRKETDTNATVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.28
4 0.22
5 0.2
6 0.14
7 0.14
8 0.15
9 0.15
10 0.15
11 0.15
12 0.19
13 0.25
14 0.32
15 0.41
16 0.48
17 0.57
18 0.66
19 0.74
20 0.81
21 0.84
22 0.82
23 0.83
24 0.84
25 0.83
26 0.82
27 0.8
28 0.78
29 0.76
30 0.76
31 0.74
32 0.68
33 0.6
34 0.53
35 0.49
36 0.46
37 0.4
38 0.31
39 0.26
40 0.25
41 0.27
42 0.25
43 0.2
44 0.14
45 0.14
46 0.13
47 0.1
48 0.08
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.06
57 0.07
58 0.08
59 0.11
60 0.19
61 0.21
62 0.23
63 0.23
64 0.23
65 0.27
66 0.27
67 0.26
68 0.19
69 0.17
70 0.16
71 0.16
72 0.14
73 0.09
74 0.07
75 0.05
76 0.05
77 0.04
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.09
85 0.11
86 0.14
87 0.19
88 0.21
89 0.23
90 0.25
91 0.29
92 0.3
93 0.34
94 0.37
95 0.38
96 0.41
97 0.43
98 0.42
99 0.47
100 0.5
101 0.54
102 0.53
103 0.54
104 0.5
105 0.5
106 0.49
107 0.46