Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZDF9

Protein Details
Accession A0A1Y1ZDF9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
142-161EERLRKRRKMADIRKQYRSFBasic
NLS Segment(s)
PositionSequence
147-149KRR
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MTPCSSRGGSPSPSTKDSLSVSSIRVNYMLRHTSHPHLLKEISEETDSELSEASLNGSASSDDSDAEKVSVTDGSDPSDDENVKSLKRLHRDGTKRLVELSEEFEALKSRLMESKIEDLDNEKKEILDGVHPEYREQQDQLEERLRKRRKMADIRKQYRSFDIQNQFDGTKKQATDTLVAERAVLRQAFMDMIQRKKRLLQKEFDALEEQSLENLEAQQDLSVMRISSLLNTQNETSVDYTQQERSFVNYVKSLNSGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.41
4 0.39
5 0.35
6 0.31
7 0.27
8 0.27
9 0.3
10 0.3
11 0.27
12 0.26
13 0.24
14 0.23
15 0.27
16 0.3
17 0.27
18 0.31
19 0.35
20 0.38
21 0.46
22 0.48
23 0.43
24 0.43
25 0.42
26 0.37
27 0.37
28 0.35
29 0.28
30 0.24
31 0.22
32 0.21
33 0.21
34 0.2
35 0.16
36 0.13
37 0.11
38 0.1
39 0.1
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.08
49 0.07
50 0.08
51 0.09
52 0.09
53 0.09
54 0.09
55 0.07
56 0.08
57 0.08
58 0.08
59 0.1
60 0.1
61 0.11
62 0.12
63 0.12
64 0.12
65 0.15
66 0.15
67 0.12
68 0.16
69 0.15
70 0.15
71 0.18
72 0.22
73 0.25
74 0.31
75 0.35
76 0.37
77 0.45
78 0.51
79 0.55
80 0.59
81 0.56
82 0.51
83 0.47
84 0.42
85 0.34
86 0.28
87 0.26
88 0.17
89 0.14
90 0.13
91 0.12
92 0.13
93 0.12
94 0.12
95 0.08
96 0.08
97 0.11
98 0.13
99 0.13
100 0.15
101 0.19
102 0.19
103 0.19
104 0.18
105 0.18
106 0.23
107 0.24
108 0.22
109 0.17
110 0.16
111 0.16
112 0.16
113 0.13
114 0.09
115 0.1
116 0.12
117 0.14
118 0.15
119 0.15
120 0.18
121 0.19
122 0.18
123 0.17
124 0.14
125 0.16
126 0.18
127 0.2
128 0.25
129 0.25
130 0.28
131 0.38
132 0.42
133 0.42
134 0.46
135 0.51
136 0.54
137 0.62
138 0.69
139 0.7
140 0.76
141 0.79
142 0.83
143 0.78
144 0.69
145 0.62
146 0.57
147 0.5
148 0.48
149 0.49
150 0.41
151 0.4
152 0.4
153 0.36
154 0.32
155 0.3
156 0.23
157 0.19
158 0.18
159 0.17
160 0.19
161 0.2
162 0.21
163 0.22
164 0.23
165 0.21
166 0.21
167 0.21
168 0.18
169 0.17
170 0.17
171 0.15
172 0.11
173 0.09
174 0.1
175 0.1
176 0.1
177 0.17
178 0.19
179 0.27
180 0.34
181 0.35
182 0.36
183 0.43
184 0.5
185 0.52
186 0.54
187 0.53
188 0.53
189 0.6
190 0.6
191 0.55
192 0.5
193 0.4
194 0.34
195 0.28
196 0.22
197 0.13
198 0.13
199 0.11
200 0.09
201 0.09
202 0.08
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.08
210 0.08
211 0.07
212 0.08
213 0.09
214 0.1
215 0.14
216 0.19
217 0.19
218 0.22
219 0.22
220 0.24
221 0.24
222 0.25
223 0.23
224 0.19
225 0.2
226 0.19
227 0.22
228 0.25
229 0.26
230 0.26
231 0.24
232 0.27
233 0.32
234 0.32
235 0.33
236 0.31
237 0.31
238 0.31