Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Z4L6

Protein Details
Accession A0A1Y1Z4L6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-131LGEHGITSRKQRKERKNRLKKLRGTAKTKGPKTKSBasic
NLS Segment(s)
PositionSequence
103-132TSRKQRKERKNRLKKLRGTAKTKGPKTKSE
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADATVTIRTRKFLTNRLLQRKQFVVDILHPGKANISKDELREKLAKMYKSDKENVFCFGFRTVFGGGKSTGFALIYDSLDSAKKFEPKYRLVRHGLGEHGITSRKQRKERKNRLKKLRGTAKTKGPKTKSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.61
4 0.69
5 0.74
6 0.69
7 0.7
8 0.65
9 0.59
10 0.5
11 0.42
12 0.35
13 0.29
14 0.35
15 0.31
16 0.3
17 0.28
18 0.26
19 0.27
20 0.27
21 0.26
22 0.19
23 0.23
24 0.23
25 0.26
26 0.33
27 0.31
28 0.31
29 0.32
30 0.31
31 0.34
32 0.37
33 0.36
34 0.33
35 0.39
36 0.4
37 0.42
38 0.47
39 0.42
40 0.41
41 0.4
42 0.39
43 0.34
44 0.28
45 0.25
46 0.21
47 0.17
48 0.13
49 0.14
50 0.12
51 0.12
52 0.12
53 0.12
54 0.11
55 0.1
56 0.11
57 0.09
58 0.08
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.09
70 0.11
71 0.16
72 0.17
73 0.23
74 0.29
75 0.35
76 0.45
77 0.5
78 0.55
79 0.55
80 0.57
81 0.55
82 0.51
83 0.46
84 0.38
85 0.3
86 0.24
87 0.21
88 0.19
89 0.17
90 0.24
91 0.31
92 0.37
93 0.46
94 0.56
95 0.65
96 0.75
97 0.86
98 0.88
99 0.9
100 0.93
101 0.95
102 0.95
103 0.93
104 0.92
105 0.92
106 0.89
107 0.86
108 0.83
109 0.82
110 0.82
111 0.82
112 0.81