Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y7H6

Protein Details
Accession A0A1Y1Y7H6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
107-136SSESKSRKNLEQRLKNKLKEHQKQRTSPNKHydrophilic
NLS Segment(s)
PositionSequence
119-126RLKNKLKE
Subcellular Location(s) nucl 25, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MSKKQKNPKKEDDDLDDLVNHILSSEPAKPDNECAEKTCRQKTSLMGFLCGYCRRKFCMKHRLPEKHSSACEEKAKIASRATYKQDSMRIITEEKKKPGSTYAPNGSSESKSRKNLEQRLKNKLKEHQKQRTSPNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.59
3 0.48
4 0.39
5 0.31
6 0.24
7 0.15
8 0.09
9 0.07
10 0.06
11 0.09
12 0.12
13 0.14
14 0.15
15 0.17
16 0.18
17 0.21
18 0.28
19 0.29
20 0.27
21 0.28
22 0.33
23 0.39
24 0.44
25 0.48
26 0.43
27 0.41
28 0.43
29 0.45
30 0.45
31 0.46
32 0.4
33 0.34
34 0.32
35 0.3
36 0.31
37 0.3
38 0.27
39 0.22
40 0.23
41 0.25
42 0.32
43 0.4
44 0.46
45 0.52
46 0.55
47 0.62
48 0.71
49 0.76
50 0.74
51 0.75
52 0.71
53 0.65
54 0.59
55 0.54
56 0.46
57 0.41
58 0.39
59 0.31
60 0.27
61 0.26
62 0.28
63 0.25
64 0.23
65 0.22
66 0.24
67 0.28
68 0.32
69 0.3
70 0.3
71 0.31
72 0.35
73 0.33
74 0.31
75 0.28
76 0.25
77 0.24
78 0.3
79 0.36
80 0.37
81 0.39
82 0.41
83 0.4
84 0.39
85 0.42
86 0.43
87 0.41
88 0.43
89 0.47
90 0.45
91 0.46
92 0.47
93 0.44
94 0.39
95 0.38
96 0.38
97 0.38
98 0.41
99 0.44
100 0.5
101 0.58
102 0.65
103 0.7
104 0.73
105 0.73
106 0.78
107 0.83
108 0.82
109 0.79
110 0.78
111 0.78
112 0.78
113 0.82
114 0.82
115 0.82
116 0.84