Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y4S2

Protein Details
Accession A0A1Y1Y4S2   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
91-116AQDDPERKVSNRKKKRKIILNSASGQHydrophilic
NLS Segment(s)
PositionSequence
98-107KVSNRKKKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MSYLHVKRAIEALSNPVVVESLVTDCTTTSTSTSTPTPTYPVDFLPNGDSMDYQYDRQPVIPPPTQSLPPVDTSIHPTPTRPDSPPEPAQAQDDPERKVSNRKKKRKIILNSASGQLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.18
4 0.17
5 0.13
6 0.12
7 0.08
8 0.06
9 0.07
10 0.07
11 0.07
12 0.07
13 0.09
14 0.1
15 0.09
16 0.09
17 0.1
18 0.11
19 0.13
20 0.14
21 0.15
22 0.16
23 0.16
24 0.18
25 0.17
26 0.19
27 0.18
28 0.18
29 0.19
30 0.18
31 0.18
32 0.16
33 0.16
34 0.14
35 0.13
36 0.12
37 0.09
38 0.12
39 0.12
40 0.11
41 0.12
42 0.13
43 0.13
44 0.14
45 0.16
46 0.15
47 0.2
48 0.22
49 0.21
50 0.23
51 0.25
52 0.25
53 0.24
54 0.23
55 0.19
56 0.17
57 0.18
58 0.16
59 0.15
60 0.21
61 0.23
62 0.24
63 0.23
64 0.22
65 0.24
66 0.29
67 0.32
68 0.27
69 0.3
70 0.3
71 0.37
72 0.41
73 0.41
74 0.37
75 0.35
76 0.36
77 0.33
78 0.32
79 0.33
80 0.33
81 0.31
82 0.32
83 0.34
84 0.32
85 0.42
86 0.49
87 0.52
88 0.59
89 0.68
90 0.76
91 0.83
92 0.92
93 0.91
94 0.91
95 0.91
96 0.89
97 0.87
98 0.79