Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YGS8

Protein Details
Accession A0A1Y1YGS8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-43KRAAKAEAPEKKTRKKRTKKDPNAPKRALSBasic
NLS Segment(s)
PositionSequence
5-40VKSREEKPSKRAAKAEAPEKKTRKKRTKKDPNAPKR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAVKSREEKPSKRAAKAEAPEKKTRKKRTKKDPNAPKRALSAFMFFSQEWREKVKTENPDVSFGQIGKILGEKWNKMDEEEKKPFTAKAEEDKKRYEAAKAAYEKNPSGGDDDEDEESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.68
3 0.63
4 0.62
5 0.64
6 0.68
7 0.66
8 0.65
9 0.69
10 0.71
11 0.76
12 0.76
13 0.8
14 0.81
15 0.83
16 0.87
17 0.89
18 0.93
19 0.94
20 0.95
21 0.95
22 0.95
23 0.94
24 0.86
25 0.77
26 0.7
27 0.6
28 0.53
29 0.43
30 0.34
31 0.26
32 0.24
33 0.24
34 0.19
35 0.19
36 0.18
37 0.2
38 0.19
39 0.21
40 0.2
41 0.19
42 0.23
43 0.28
44 0.31
45 0.32
46 0.37
47 0.34
48 0.37
49 0.36
50 0.33
51 0.27
52 0.22
53 0.18
54 0.12
55 0.11
56 0.07
57 0.08
58 0.07
59 0.12
60 0.14
61 0.14
62 0.16
63 0.19
64 0.19
65 0.2
66 0.27
67 0.29
68 0.36
69 0.42
70 0.41
71 0.39
72 0.4
73 0.4
74 0.36
75 0.34
76 0.29
77 0.32
78 0.4
79 0.46
80 0.49
81 0.52
82 0.51
83 0.5
84 0.47
85 0.41
86 0.36
87 0.35
88 0.39
89 0.41
90 0.44
91 0.44
92 0.47
93 0.44
94 0.42
95 0.38
96 0.3
97 0.29
98 0.25
99 0.22
100 0.21
101 0.23