Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Y804

Protein Details
Accession A0A1Y1Y804    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-69TLAPTPTPKKTKKRHSATQTTYTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6cyto 6plas 6cyto_mito 6, extr 4
Family & Domain DBs
Amino Acid Sequences MKFAPVVFILFVMLLNLTVTEAVARRRPRRGIKDIHGNTLSYVIVTLAPTPTPKKTKKRHSATQTTYTATPVLPTPTVTSTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.09
10 0.16
11 0.23
12 0.28
13 0.34
14 0.42
15 0.51
16 0.58
17 0.63
18 0.65
19 0.65
20 0.71
21 0.66
22 0.64
23 0.55
24 0.47
25 0.39
26 0.32
27 0.25
28 0.13
29 0.11
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.07
37 0.1
38 0.15
39 0.22
40 0.31
41 0.4
42 0.5
43 0.61
44 0.7
45 0.77
46 0.82
47 0.84
48 0.87
49 0.84
50 0.83
51 0.75
52 0.67
53 0.59
54 0.5
55 0.41
56 0.29
57 0.24
58 0.17
59 0.17
60 0.15
61 0.15
62 0.18