Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XJM6

Protein Details
Accession A0A1Y1XJM6    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-46GKVKSQCPKVEKQEKKKKKTGRAKKRIQYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
19-37KVEKQEKKKKKTGRAKKRI
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQCPKVEKQEKKKKKTGRAKKRIQYNRRFVNVTNLIGGKRRMNPAPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.5
4 0.53
5 0.6
6 0.64
7 0.7
8 0.72
9 0.75
10 0.79
11 0.83
12 0.85
13 0.86
14 0.84
15 0.84
16 0.85
17 0.85
18 0.86
19 0.86
20 0.88
21 0.85
22 0.87
23 0.87
24 0.87
25 0.86
26 0.84
27 0.82
28 0.76
29 0.72
30 0.62
31 0.62
32 0.56
33 0.47
34 0.4
35 0.33
36 0.29
37 0.31
38 0.33
39 0.28
40 0.29
41 0.34
42 0.36