Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YNK3

Protein Details
Accession A0A1Y1YNK3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-124PLDLRHKKTRAIRRRLTKFEATRTTLRQQKKSIHFPQRKFAVKHydrophilic
NLS Segment(s)
PositionSequence
86-97RHKKTRAIRRRL
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVKAHELRNQSKDELKKQLDELKQELSSLRVQKVAGGAASKLTRINAVRKSIARVLTVITQTERQNIRLLYKQEGRKYLPLDLRHKKTRAIRRRLTKFEATRTTLRQQKKSIHFPQRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.6
4 0.53
5 0.51
6 0.52
7 0.57
8 0.53
9 0.51
10 0.47
11 0.41
12 0.38
13 0.36
14 0.32
15 0.26
16 0.27
17 0.26
18 0.24
19 0.21
20 0.21
21 0.21
22 0.22
23 0.2
24 0.15
25 0.12
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.1
32 0.13
33 0.14
34 0.21
35 0.23
36 0.26
37 0.29
38 0.29
39 0.33
40 0.33
41 0.33
42 0.27
43 0.22
44 0.2
45 0.19
46 0.19
47 0.16
48 0.13
49 0.14
50 0.14
51 0.19
52 0.19
53 0.17
54 0.2
55 0.2
56 0.22
57 0.24
58 0.26
59 0.26
60 0.32
61 0.36
62 0.37
63 0.41
64 0.41
65 0.41
66 0.4
67 0.41
68 0.4
69 0.42
70 0.48
71 0.52
72 0.57
73 0.6
74 0.6
75 0.6
76 0.63
77 0.67
78 0.68
79 0.69
80 0.71
81 0.75
82 0.82
83 0.83
84 0.81
85 0.8
86 0.75
87 0.74
88 0.72
89 0.66
90 0.62
91 0.6
92 0.61
93 0.6
94 0.62
95 0.6
96 0.6
97 0.64
98 0.68
99 0.73
100 0.75
101 0.79
102 0.8
103 0.78
104 0.81
105 0.8