Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y9X9

Protein Details
Accession A0A1Y1Y9X9   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSKVKKRNYRKRQVEEDETSNHydrophilic
63-86VLDKGDPKSKKKRQDVKKDEEGEEBasic
NLS Segment(s)
PositionSequence
69-80PKSKKKRQDVKK
217-218KR
220-220R
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR010756  Tls1-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF07052  Hep_59  
Amino Acid Sequences MSKVKKRNYRKRQVEEDETSNSISRESTPTAASEEPTEVGENLEELLELRKFRRRQQGIDVQVLDKGDPKSKKKRQDVKKDEEGEEKRPKVLETFTTQTDALDVDKHMMAYIEEEMRKRNGNPSEEDEAAGGQSTSNELFQVPDHLKVEKKPINETNINLSTTMLTAIPEVDLGIDTRLRNIEETEKAKLRMLLNERDMNVGSAKSTDKVVLERFKKRYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.85
3 0.79
4 0.72
5 0.62
6 0.54
7 0.45
8 0.36
9 0.27
10 0.21
11 0.18
12 0.18
13 0.19
14 0.19
15 0.18
16 0.19
17 0.23
18 0.23
19 0.21
20 0.19
21 0.17
22 0.16
23 0.16
24 0.16
25 0.12
26 0.12
27 0.11
28 0.09
29 0.08
30 0.07
31 0.06
32 0.05
33 0.08
34 0.09
35 0.1
36 0.13
37 0.21
38 0.24
39 0.32
40 0.43
41 0.46
42 0.49
43 0.58
44 0.66
45 0.62
46 0.65
47 0.59
48 0.48
49 0.44
50 0.39
51 0.29
52 0.24
53 0.2
54 0.21
55 0.26
56 0.33
57 0.42
58 0.5
59 0.6
60 0.67
61 0.75
62 0.79
63 0.84
64 0.87
65 0.85
66 0.86
67 0.81
68 0.73
69 0.72
70 0.65
71 0.61
72 0.59
73 0.51
74 0.43
75 0.38
76 0.36
77 0.29
78 0.27
79 0.22
80 0.2
81 0.22
82 0.21
83 0.23
84 0.22
85 0.2
86 0.18
87 0.15
88 0.1
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.08
100 0.09
101 0.09
102 0.11
103 0.12
104 0.14
105 0.13
106 0.19
107 0.22
108 0.24
109 0.27
110 0.31
111 0.34
112 0.33
113 0.33
114 0.26
115 0.2
116 0.18
117 0.14
118 0.08
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.06
127 0.06
128 0.11
129 0.11
130 0.14
131 0.15
132 0.17
133 0.18
134 0.2
135 0.29
136 0.27
137 0.28
138 0.32
139 0.36
140 0.42
141 0.43
142 0.43
143 0.42
144 0.41
145 0.4
146 0.33
147 0.28
148 0.22
149 0.19
150 0.18
151 0.09
152 0.07
153 0.06
154 0.06
155 0.06
156 0.05
157 0.05
158 0.04
159 0.05
160 0.05
161 0.06
162 0.09
163 0.09
164 0.1
165 0.12
166 0.13
167 0.14
168 0.16
169 0.2
170 0.25
171 0.28
172 0.33
173 0.36
174 0.36
175 0.38
176 0.4
177 0.36
178 0.38
179 0.4
180 0.42
181 0.44
182 0.48
183 0.46
184 0.44
185 0.42
186 0.35
187 0.31
188 0.23
189 0.17
190 0.15
191 0.16
192 0.14
193 0.15
194 0.15
195 0.16
196 0.2
197 0.27
198 0.34
199 0.4
200 0.48
201 0.56