Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PPD9

Protein Details
Accession B8PPD9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-29FDPALIPRRKQPKNSQQVVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007590  Saf4/Yju2  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
KEGG ppl:POSPLDRAFT_38177  -  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences VLNKYFPPDFDPALIPRRKQPKNSQQVVRLMAPFSMRCNTCGEYIYKGKKFNARKETVDGEDYYGIKIFRFYIKCTLCSAEITFKTDPKNTDYSAEHGASRNFEPWREEKAVEEEDRLAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.4
4 0.49
5 0.52
6 0.58
7 0.65
8 0.67
9 0.73
10 0.81
11 0.8
12 0.76
13 0.76
14 0.72
15 0.63
16 0.54
17 0.43
18 0.35
19 0.3
20 0.24
21 0.2
22 0.21
23 0.19
24 0.19
25 0.22
26 0.22
27 0.22
28 0.23
29 0.22
30 0.21
31 0.28
32 0.34
33 0.33
34 0.34
35 0.36
36 0.42
37 0.48
38 0.52
39 0.55
40 0.52
41 0.51
42 0.53
43 0.53
44 0.47
45 0.42
46 0.32
47 0.24
48 0.21
49 0.18
50 0.14
51 0.12
52 0.1
53 0.08
54 0.08
55 0.08
56 0.12
57 0.14
58 0.16
59 0.24
60 0.25
61 0.27
62 0.28
63 0.29
64 0.24
65 0.25
66 0.24
67 0.22
68 0.22
69 0.25
70 0.24
71 0.25
72 0.27
73 0.29
74 0.29
75 0.27
76 0.3
77 0.27
78 0.3
79 0.29
80 0.3
81 0.31
82 0.3
83 0.27
84 0.26
85 0.26
86 0.25
87 0.24
88 0.26
89 0.22
90 0.23
91 0.27
92 0.28
93 0.34
94 0.35
95 0.34
96 0.32
97 0.37
98 0.42
99 0.38
100 0.37