Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YUL5

Protein Details
Accession A0A1Y1YUL5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-112KPVAKPKPVVKKPNVDNKKKVPGPBasic
NLS Segment(s)
PositionSequence
36-124GQAAKPKPVAKPKPVAKPSCSEAKPVAKPKPVAKPKPVTKPKPVAKPKPVAKPKPVAKPKPVVKKPNVDNKKKVPGPGNGKKPVAKGRN
Subcellular Location(s) extr 22, E.R. 4
Family & Domain DBs
Amino Acid Sequences MRFTSPLILIIFFVALAINAAQAGALPSKGVSRNGGQAAKPKPVAKPKPVAKPSCSEAKPVAKPKPVAKPKPVTKPKPVAKPKPVAKPKPVAKPKPVVKKPNVDNKKKVPGPGNGKKPVAKGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.03
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.09
16 0.11
17 0.13
18 0.14
19 0.15
20 0.2
21 0.25
22 0.27
23 0.26
24 0.31
25 0.33
26 0.35
27 0.36
28 0.33
29 0.35
30 0.43
31 0.48
32 0.46
33 0.53
34 0.55
35 0.62
36 0.67
37 0.66
38 0.58
39 0.55
40 0.52
41 0.51
42 0.45
43 0.37
44 0.34
45 0.36
46 0.4
47 0.43
48 0.45
49 0.4
50 0.42
51 0.45
52 0.51
53 0.53
54 0.53
55 0.54
56 0.58
57 0.61
58 0.69
59 0.74
60 0.7
61 0.69
62 0.73
63 0.73
64 0.75
65 0.77
66 0.76
67 0.74
68 0.77
69 0.76
70 0.76
71 0.79
72 0.73
73 0.7
74 0.69
75 0.69
76 0.7
77 0.72
78 0.67
79 0.65
80 0.69
81 0.72
82 0.74
83 0.76
84 0.75
85 0.73
86 0.77
87 0.78
88 0.8
89 0.81
90 0.79
91 0.78
92 0.78
93 0.81
94 0.75
95 0.73
96 0.68
97 0.68
98 0.7
99 0.71
100 0.72
101 0.69
102 0.7
103 0.68
104 0.68