Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YCA5

Protein Details
Accession A0A1Y1YCA5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-30DESKRQRVSRACDHCRRKKVRCDGVQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTSGDESKRQRVSRACDHCRRKKVRCDGVQPCCGHCKILNIECTYLDVTKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.69
4 0.78
5 0.8
6 0.83
7 0.84
8 0.81
9 0.81
10 0.82
11 0.82
12 0.79
13 0.79
14 0.78
15 0.76
16 0.75
17 0.66
18 0.57
19 0.52
20 0.45
21 0.37
22 0.29
23 0.28
24 0.28
25 0.33
26 0.37
27 0.35
28 0.36
29 0.34
30 0.35
31 0.31
32 0.26