Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YN13

Protein Details
Accession A0A1Y1YN13   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MEYKKIAVKKFPRLPNRKTPEARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, pero 3
Family & Domain DBs
Amino Acid Sequences MEYKKIAVKKFPRLPNRKTPEARYWRKFKVTWRFPWCWRADVWDRFGILPRPTCFALVNCFPFCLVAHPYQRVRFGHLHQLFACSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.82
4 0.81
5 0.77
6 0.75
7 0.75
8 0.76
9 0.79
10 0.76
11 0.76
12 0.72
13 0.72
14 0.68
15 0.66
16 0.67
17 0.65
18 0.67
19 0.67
20 0.66
21 0.64
22 0.69
23 0.62
24 0.52
25 0.44
26 0.4
27 0.4
28 0.38
29 0.38
30 0.31
31 0.29
32 0.28
33 0.3
34 0.27
35 0.21
36 0.22
37 0.2
38 0.21
39 0.21
40 0.22
41 0.21
42 0.18
43 0.21
44 0.21
45 0.24
46 0.22
47 0.21
48 0.2
49 0.2
50 0.19
51 0.18
52 0.17
53 0.19
54 0.24
55 0.29
56 0.34
57 0.37
58 0.43
59 0.4
60 0.43
61 0.42
62 0.41
63 0.47
64 0.44
65 0.46
66 0.4
67 0.43