Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y2B4

Protein Details
Accession A0A1Y1Y2B4   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-121PLDLRYKKTRAIRRRLTKFEATRTTVRQHKKSIHFPQRKFHydrophilic
NLS Segment(s)
PositionSequence
91-96RAIRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVKAHELRNQSKEELKKQLDELKQELSSLRVQKVAGGAASKLTRINAVRKSIARVLTVITQTERQNIRLLYKQENRKYLPLDLRYKKTRAIRRRLTKFEATRTTVRQHKKSIHFPQRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.6
4 0.53
5 0.51
6 0.52
7 0.57
8 0.53
9 0.51
10 0.47
11 0.41
12 0.38
13 0.36
14 0.32
15 0.26
16 0.27
17 0.26
18 0.24
19 0.21
20 0.21
21 0.21
22 0.22
23 0.2
24 0.15
25 0.12
26 0.11
27 0.12
28 0.12
29 0.12
30 0.11
31 0.1
32 0.13
33 0.14
34 0.21
35 0.23
36 0.26
37 0.29
38 0.29
39 0.33
40 0.33
41 0.33
42 0.27
43 0.22
44 0.2
45 0.19
46 0.19
47 0.16
48 0.13
49 0.14
50 0.14
51 0.19
52 0.19
53 0.17
54 0.2
55 0.2
56 0.22
57 0.24
58 0.27
59 0.3
60 0.37
61 0.45
62 0.47
63 0.52
64 0.52
65 0.51
66 0.5
67 0.47
68 0.47
69 0.46
70 0.5
71 0.5
72 0.55
73 0.56
74 0.56
75 0.56
76 0.58
77 0.61
78 0.61
79 0.65
80 0.69
81 0.74
82 0.82
83 0.83
84 0.81
85 0.81
86 0.77
87 0.75
88 0.72
89 0.66
90 0.62
91 0.59
92 0.59
93 0.58
94 0.61
95 0.59
96 0.59
97 0.64
98 0.67
99 0.73
100 0.77
101 0.8
102 0.81
103 0.78
104 0.8
105 0.8