Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y591

Protein Details
Accession A0A1Y1Y591    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-143SEDIKEERKKAKANRNKYTGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013809  ENTH  
IPR008942  ENTH_VHS  
Pfam View protein in Pfam  
PF01417  ENTH  
PROSITE View protein in PROSITE  
PS50942  ENTH  
CDD cd16992  ENTH_Ent3  
Amino Acid Sequences NYTEMEAKVREATNNDPWGASSTLMQEIAQGTYNFQYFNEIMGTIYKRFTEKEAKDWRQIYKALTLLEYLIKNGSEKVIDDARGHLSMIKMFRSFHYIDEKNKDQGVNVRTRAKLIVDLLSNSEDIKEERKKAKANRNKYTGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.31
4 0.3
5 0.31
6 0.29
7 0.23
8 0.16
9 0.15
10 0.16
11 0.16
12 0.15
13 0.12
14 0.12
15 0.13
16 0.14
17 0.12
18 0.12
19 0.13
20 0.14
21 0.13
22 0.12
23 0.15
24 0.12
25 0.13
26 0.13
27 0.11
28 0.11
29 0.14
30 0.16
31 0.12
32 0.13
33 0.13
34 0.13
35 0.14
36 0.18
37 0.25
38 0.24
39 0.33
40 0.43
41 0.46
42 0.52
43 0.54
44 0.53
45 0.47
46 0.47
47 0.38
48 0.31
49 0.29
50 0.23
51 0.2
52 0.17
53 0.14
54 0.15
55 0.14
56 0.1
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.06
63 0.06
64 0.09
65 0.1
66 0.11
67 0.11
68 0.13
69 0.14
70 0.14
71 0.14
72 0.12
73 0.11
74 0.12
75 0.13
76 0.13
77 0.13
78 0.13
79 0.14
80 0.18
81 0.18
82 0.18
83 0.26
84 0.28
85 0.32
86 0.39
87 0.41
88 0.39
89 0.4
90 0.38
91 0.3
92 0.34
93 0.34
94 0.34
95 0.36
96 0.39
97 0.38
98 0.39
99 0.39
100 0.33
101 0.31
102 0.25
103 0.24
104 0.2
105 0.2
106 0.21
107 0.21
108 0.2
109 0.16
110 0.15
111 0.12
112 0.12
113 0.19
114 0.24
115 0.3
116 0.37
117 0.44
118 0.52
119 0.61
120 0.7
121 0.73
122 0.77
123 0.8