Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PLJ4

Protein Details
Accession B8PLJ4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-83ESQIRREHTCRPRSQKPEARSHydrophilic
NLS Segment(s)
PositionSequence
124-162RGRHGRAAGARASPSRVGRSGDARRLRAPAPRRAAPRPA
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_99603  -  
Amino Acid Sequences MIKRGAARLSRPITGSAWSRHLRKTIRAYNTSLRPAFDKSEVPCTSLLPRPGQLRRPHPASSESQIRREHTCRPRSQKPEARSQKPTSGILQGGSGAGSPHARVRARVAHRTRDENACGMRYARGRHGRAAGARASPSRVGRSGDARRLRAPAPRRAAPRPAPASLPSGAVGSGYRGPSVGPPLGRVSTGHRGSGRVGQRTAALGGVPGTVRARACAPQIVATAAVHARACGGVVCVHEGEGKGKGKGEGECIFGQWTGGGGHPAASMGMFHVDGAITRGAELLRAGITARMGAHLEHEEPKGGRDGDEAGVFVKISQKGALSHACPRGLLVKPIEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.34
4 0.38
5 0.4
6 0.43
7 0.45
8 0.52
9 0.52
10 0.55
11 0.61
12 0.62
13 0.66
14 0.66
15 0.68
16 0.68
17 0.71
18 0.7
19 0.61
20 0.54
21 0.47
22 0.46
23 0.44
24 0.38
25 0.36
26 0.3
27 0.39
28 0.38
29 0.36
30 0.33
31 0.31
32 0.33
33 0.33
34 0.35
35 0.28
36 0.32
37 0.38
38 0.45
39 0.5
40 0.54
41 0.57
42 0.61
43 0.62
44 0.61
45 0.56
46 0.54
47 0.51
48 0.49
49 0.52
50 0.47
51 0.49
52 0.5
53 0.5
54 0.52
55 0.5
56 0.54
57 0.53
58 0.59
59 0.62
60 0.66
61 0.74
62 0.74
63 0.82
64 0.81
65 0.76
66 0.77
67 0.78
68 0.76
69 0.75
70 0.72
71 0.68
72 0.63
73 0.61
74 0.52
75 0.46
76 0.39
77 0.31
78 0.26
79 0.19
80 0.15
81 0.13
82 0.1
83 0.06
84 0.06
85 0.06
86 0.06
87 0.08
88 0.14
89 0.15
90 0.15
91 0.2
92 0.28
93 0.34
94 0.43
95 0.46
96 0.5
97 0.54
98 0.58
99 0.57
100 0.53
101 0.49
102 0.44
103 0.4
104 0.32
105 0.29
106 0.24
107 0.24
108 0.22
109 0.23
110 0.27
111 0.34
112 0.34
113 0.37
114 0.39
115 0.39
116 0.37
117 0.38
118 0.32
119 0.25
120 0.25
121 0.22
122 0.21
123 0.2
124 0.2
125 0.19
126 0.19
127 0.19
128 0.19
129 0.26
130 0.3
131 0.35
132 0.39
133 0.38
134 0.38
135 0.39
136 0.39
137 0.38
138 0.39
139 0.39
140 0.4
141 0.43
142 0.47
143 0.47
144 0.53
145 0.51
146 0.53
147 0.48
148 0.43
149 0.4
150 0.36
151 0.35
152 0.29
153 0.24
154 0.16
155 0.13
156 0.11
157 0.1
158 0.08
159 0.07
160 0.08
161 0.08
162 0.07
163 0.07
164 0.07
165 0.08
166 0.11
167 0.11
168 0.09
169 0.11
170 0.13
171 0.13
172 0.13
173 0.13
174 0.15
175 0.22
176 0.23
177 0.24
178 0.23
179 0.23
180 0.25
181 0.31
182 0.3
183 0.25
184 0.25
185 0.23
186 0.23
187 0.23
188 0.22
189 0.15
190 0.1
191 0.07
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.07
198 0.07
199 0.08
200 0.1
201 0.11
202 0.12
203 0.14
204 0.14
205 0.15
206 0.16
207 0.15
208 0.14
209 0.12
210 0.13
211 0.1
212 0.11
213 0.08
214 0.08
215 0.07
216 0.06
217 0.07
218 0.05
219 0.06
220 0.07
221 0.07
222 0.09
223 0.09
224 0.09
225 0.1
226 0.11
227 0.11
228 0.15
229 0.17
230 0.16
231 0.17
232 0.18
233 0.2
234 0.2
235 0.25
236 0.21
237 0.23
238 0.23
239 0.22
240 0.22
241 0.19
242 0.18
243 0.12
244 0.11
245 0.07
246 0.07
247 0.08
248 0.07
249 0.07
250 0.07
251 0.08
252 0.06
253 0.06
254 0.05
255 0.05
256 0.06
257 0.06
258 0.05
259 0.06
260 0.06
261 0.06
262 0.08
263 0.08
264 0.07
265 0.07
266 0.08
267 0.08
268 0.08
269 0.08
270 0.07
271 0.07
272 0.07
273 0.07
274 0.07
275 0.08
276 0.09
277 0.09
278 0.09
279 0.1
280 0.09
281 0.12
282 0.14
283 0.16
284 0.18
285 0.19
286 0.21
287 0.21
288 0.23
289 0.25
290 0.23
291 0.21
292 0.19
293 0.22
294 0.2
295 0.2
296 0.19
297 0.14
298 0.14
299 0.13
300 0.12
301 0.16
302 0.15
303 0.15
304 0.16
305 0.18
306 0.19
307 0.24
308 0.29
309 0.26
310 0.33
311 0.38
312 0.37
313 0.35
314 0.35
315 0.37
316 0.34
317 0.37
318 0.33