Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YLX6

Protein Details
Accession A0A1Y1YLX6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-47GKVKSQCPKVEKQEKKKKKTGRAKKRIQYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
20-38KVEKQEKKKKKTGRAKKRI
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKKKKKTGRAKKRIQYNRRFVNVTNLIGGKRRMNPAPTSDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.49
4 0.5
5 0.52
6 0.6
7 0.63
8 0.69
9 0.72
10 0.75
11 0.79
12 0.83
13 0.85
14 0.86
15 0.84
16 0.84
17 0.85
18 0.86
19 0.86
20 0.86
21 0.88
22 0.85
23 0.87
24 0.87
25 0.86
26 0.85
27 0.84
28 0.81
29 0.76
30 0.72
31 0.62
32 0.61
33 0.56
34 0.46
35 0.4
36 0.32
37 0.29
38 0.3
39 0.32
40 0.27
41 0.28
42 0.33
43 0.34
44 0.38
45 0.41