Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XVC6

Protein Details
Accession A0A1Y1XVC6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-44PSEPPDPSKPTKRKRLTQACDTCRKKKVKCDGNRPSCSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNNNNPSEPPDPSKPTKRKRLTQACDTCRKKKVKCDGNRPSCSNCIRLKVPCTYLPSLKKRGPRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.75
4 0.77
5 0.78
6 0.83
7 0.86
8 0.83
9 0.83
10 0.84
11 0.8
12 0.82
13 0.79
14 0.75
15 0.72
16 0.72
17 0.65
18 0.64
19 0.67
20 0.67
21 0.7
22 0.74
23 0.77
24 0.8
25 0.81
26 0.76
27 0.69
28 0.66
29 0.59
30 0.54
31 0.47
32 0.42
33 0.4
34 0.41
35 0.42
36 0.4
37 0.42
38 0.41
39 0.44
40 0.43
41 0.47
42 0.51
43 0.55
44 0.58
45 0.59
46 0.64