Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P9J5

Protein Details
Accession B8P9J5    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
288-308AEPPDLRKRRKQDSLHAYRLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11.333, cyto 9.5, mito_nucl 8.833, mito 4.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_99715  -  
Amino Acid Sequences MSAPSAPSVIDLTSAKHVQLQHWIDAINQNTGKKLIALSGKVDKLWECMARHYGLNLAQAIEPASPASSPHPINEEIQCRQWAHLRDLADEWREKAARAPLLVSPGLSTPMAAASLASLPSTPSHQAKMTFDTVRSWVEAAQAGNPYAIAGLSVAQWLLVPDGTSVAGPSSLLVNTVSMSNQVPTANATTSLIEATSEELLTPSSVQENDRAILDACQKDFAALEHVTGIHDVIAQVENGSVARLRTQYGGTWAWETIKVGICRRECLYGELQDAFGGDKDHFYAFFAEPPDLRKRRKQDSLHAYRLVVEAIPHCKKDIAHEQLKPEYQDVFSTFSEQCWCERWKSMNDWEIWRELGLEWYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.23
4 0.25
5 0.24
6 0.33
7 0.34
8 0.31
9 0.31
10 0.31
11 0.29
12 0.34
13 0.33
14 0.31
15 0.3
16 0.28
17 0.28
18 0.29
19 0.27
20 0.22
21 0.21
22 0.19
23 0.22
24 0.23
25 0.26
26 0.32
27 0.33
28 0.32
29 0.33
30 0.28
31 0.26
32 0.29
33 0.3
34 0.24
35 0.27
36 0.31
37 0.31
38 0.31
39 0.28
40 0.27
41 0.24
42 0.26
43 0.22
44 0.19
45 0.17
46 0.17
47 0.18
48 0.14
49 0.12
50 0.09
51 0.08
52 0.07
53 0.08
54 0.11
55 0.15
56 0.16
57 0.17
58 0.21
59 0.22
60 0.25
61 0.3
62 0.33
63 0.3
64 0.33
65 0.35
66 0.32
67 0.32
68 0.36
69 0.33
70 0.32
71 0.33
72 0.31
73 0.29
74 0.31
75 0.33
76 0.31
77 0.28
78 0.25
79 0.26
80 0.25
81 0.24
82 0.25
83 0.27
84 0.25
85 0.25
86 0.25
87 0.21
88 0.24
89 0.24
90 0.2
91 0.15
92 0.13
93 0.14
94 0.12
95 0.1
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.04
102 0.06
103 0.06
104 0.05
105 0.05
106 0.06
107 0.06
108 0.09
109 0.12
110 0.12
111 0.15
112 0.17
113 0.19
114 0.21
115 0.25
116 0.27
117 0.25
118 0.24
119 0.24
120 0.24
121 0.22
122 0.2
123 0.16
124 0.12
125 0.12
126 0.13
127 0.12
128 0.12
129 0.12
130 0.11
131 0.11
132 0.1
133 0.09
134 0.07
135 0.06
136 0.04
137 0.03
138 0.03
139 0.03
140 0.04
141 0.03
142 0.03
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.07
169 0.07
170 0.06
171 0.07
172 0.08
173 0.07
174 0.08
175 0.08
176 0.07
177 0.07
178 0.07
179 0.06
180 0.05
181 0.05
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.04
191 0.05
192 0.06
193 0.07
194 0.1
195 0.11
196 0.11
197 0.11
198 0.12
199 0.11
200 0.12
201 0.17
202 0.16
203 0.15
204 0.16
205 0.15
206 0.14
207 0.14
208 0.12
209 0.12
210 0.1
211 0.1
212 0.1
213 0.1
214 0.1
215 0.1
216 0.09
217 0.05
218 0.05
219 0.05
220 0.05
221 0.06
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.06
228 0.05
229 0.05
230 0.07
231 0.08
232 0.09
233 0.11
234 0.12
235 0.12
236 0.16
237 0.17
238 0.16
239 0.17
240 0.16
241 0.16
242 0.16
243 0.16
244 0.14
245 0.18
246 0.2
247 0.22
248 0.29
249 0.29
250 0.31
251 0.32
252 0.34
253 0.29
254 0.31
255 0.32
256 0.29
257 0.3
258 0.28
259 0.26
260 0.21
261 0.2
262 0.16
263 0.12
264 0.1
265 0.08
266 0.08
267 0.09
268 0.1
269 0.09
270 0.1
271 0.13
272 0.13
273 0.16
274 0.17
275 0.17
276 0.17
277 0.22
278 0.31
279 0.34
280 0.39
281 0.45
282 0.52
283 0.6
284 0.7
285 0.72
286 0.73
287 0.77
288 0.82
289 0.8
290 0.74
291 0.65
292 0.57
293 0.5
294 0.4
295 0.29
296 0.21
297 0.17
298 0.23
299 0.26
300 0.25
301 0.26
302 0.27
303 0.27
304 0.34
305 0.4
306 0.41
307 0.45
308 0.49
309 0.54
310 0.58
311 0.62
312 0.55
313 0.47
314 0.4
315 0.33
316 0.32
317 0.28
318 0.26
319 0.23
320 0.25
321 0.24
322 0.23
323 0.27
324 0.24
325 0.24
326 0.25
327 0.28
328 0.27
329 0.34
330 0.39
331 0.41
332 0.48
333 0.55
334 0.57
335 0.58
336 0.6
337 0.57
338 0.53
339 0.47
340 0.39
341 0.31
342 0.25