Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WZM9

Protein Details
Accession A0A1Y1WZM9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-48EDLVLRWRNRRKGKCNIDHGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR029052  Metallo-depent_PP-like  
Amino Acid Sequences MVTKGPDSVGTLARAKEINALCVRGNHEDLVLRWRNRRKGKCNIDHGGNEHRRLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.22
4 0.2
5 0.22
6 0.21
7 0.23
8 0.21
9 0.23
10 0.25
11 0.21
12 0.22
13 0.16
14 0.15
15 0.14
16 0.14
17 0.2
18 0.23
19 0.22
20 0.29
21 0.36
22 0.45
23 0.54
24 0.64
25 0.65
26 0.7
27 0.79
28 0.81
29 0.83
30 0.8
31 0.76
32 0.7
33 0.67
34 0.67
35 0.62
36 0.56