Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YWS7

Protein Details
Accession A0A1Y1YWS7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21PSLSKLVKRVIRKCRIRTPTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR006671  Cyclin_N  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences PSLSKLVKRVIRKCRIRTPTLLVALVYIDRLREYLPAQAIGSPTTGHRVFLASLILASKFHDDASLWCADVAHIVYKYWDLSEINEMERVFLNYVNFDLWVDQEQLRNYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.79
4 0.75
5 0.72
6 0.7
7 0.63
8 0.55
9 0.44
10 0.37
11 0.32
12 0.25
13 0.18
14 0.1
15 0.07
16 0.06
17 0.07
18 0.07
19 0.08
20 0.09
21 0.12
22 0.13
23 0.14
24 0.14
25 0.15
26 0.15
27 0.13
28 0.13
29 0.09
30 0.09
31 0.13
32 0.12
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.08
57 0.09
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.09
64 0.1
65 0.09
66 0.1
67 0.08
68 0.1
69 0.15
70 0.15
71 0.16
72 0.18
73 0.18
74 0.17
75 0.18
76 0.18
77 0.14
78 0.15
79 0.14
80 0.12
81 0.13
82 0.13
83 0.12
84 0.11
85 0.1
86 0.1
87 0.12
88 0.14
89 0.15
90 0.19