Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P4H2

Protein Details
Accession B8P4H2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
231-258QTRTQARNISSQNKKQRRGHVRHQDATTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11plas 11, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045340  DUF6533  
Gene Ontology GO:0016020  C:membrane  
KEGG ppl:POSPLDRAFT_100716  -  
Pfam View protein in Pfam  
PF20151  DUF6533  
Amino Acid Sequences MSVDSSAETQAIAFFQATFLNNYCQLSITTLIIYEHLITAAGEVRLLRERKFSNSGLIFLFNRYTLLAFGIINAVYVYPWDTPISCEAMSMLYDILQIILYAVAAAFSALRVYAINDRDWLSAMLTLILGLPPVAVNIFYTAIASYDTVSWIVGNPECNGGNDLSQSTENKFEEKSLEAVVGNTDTQRCCLLALNVIQMALELSEGPYFGVASEFIAMDLPYGEPDDVDVQTRTQARNISSQNKKQRRGHVRHQDATTIYIKLEVDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.1
4 0.11
5 0.14
6 0.15
7 0.18
8 0.2
9 0.21
10 0.21
11 0.19
12 0.19
13 0.19
14 0.19
15 0.16
16 0.13
17 0.13
18 0.13
19 0.12
20 0.12
21 0.1
22 0.08
23 0.07
24 0.07
25 0.06
26 0.07
27 0.09
28 0.08
29 0.08
30 0.08
31 0.1
32 0.17
33 0.19
34 0.2
35 0.24
36 0.27
37 0.32
38 0.38
39 0.37
40 0.38
41 0.38
42 0.39
43 0.33
44 0.34
45 0.28
46 0.24
47 0.24
48 0.15
49 0.14
50 0.13
51 0.12
52 0.09
53 0.09
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.05
63 0.05
64 0.06
65 0.05
66 0.07
67 0.07
68 0.08
69 0.09
70 0.11
71 0.14
72 0.12
73 0.12
74 0.11
75 0.11
76 0.11
77 0.1
78 0.08
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.05
100 0.09
101 0.11
102 0.11
103 0.13
104 0.14
105 0.14
106 0.15
107 0.14
108 0.1
109 0.09
110 0.09
111 0.07
112 0.06
113 0.06
114 0.05
115 0.04
116 0.04
117 0.03
118 0.03
119 0.02
120 0.02
121 0.02
122 0.02
123 0.03
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.06
140 0.07
141 0.08
142 0.08
143 0.1
144 0.1
145 0.11
146 0.12
147 0.1
148 0.1
149 0.1
150 0.09
151 0.09
152 0.1
153 0.11
154 0.11
155 0.15
156 0.15
157 0.16
158 0.16
159 0.15
160 0.16
161 0.16
162 0.16
163 0.12
164 0.13
165 0.11
166 0.11
167 0.11
168 0.1
169 0.09
170 0.08
171 0.1
172 0.09
173 0.1
174 0.11
175 0.1
176 0.1
177 0.11
178 0.11
179 0.14
180 0.15
181 0.16
182 0.15
183 0.15
184 0.14
185 0.12
186 0.11
187 0.07
188 0.05
189 0.04
190 0.04
191 0.04
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.04
199 0.05
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.07
210 0.07
211 0.06
212 0.08
213 0.1
214 0.1
215 0.13
216 0.13
217 0.12
218 0.18
219 0.22
220 0.21
221 0.22
222 0.26
223 0.26
224 0.34
225 0.41
226 0.46
227 0.52
228 0.61
229 0.69
230 0.74
231 0.82
232 0.81
233 0.85
234 0.86
235 0.85
236 0.86
237 0.87
238 0.87
239 0.85
240 0.8
241 0.74
242 0.64
243 0.6
244 0.51
245 0.41
246 0.31
247 0.26