Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PD01

Protein Details
Accession B8PD01   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-91PMGVTWKFCKRWRWRCQRTSFTGHKSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9extr 9, mito 4, E.R. 3
Family & Domain DBs
KEGG ppl:POSPLDRAFT_96236  -  
Amino Acid Sequences MRLSWLSILSLAVLVGLASAAPVAEPALEQREAYEQRSAPEAVAYFAMNHSLCDTERNHTSHVATPMGVTWKFCKRWRWRCQRTSFTGHKSLDPCGDNIRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.03
11 0.03
12 0.03
13 0.05
14 0.08
15 0.09
16 0.09
17 0.1
18 0.16
19 0.18
20 0.2
21 0.23
22 0.2
23 0.2
24 0.23
25 0.23
26 0.16
27 0.16
28 0.14
29 0.1
30 0.1
31 0.09
32 0.07
33 0.07
34 0.09
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.1
41 0.11
42 0.12
43 0.16
44 0.18
45 0.19
46 0.19
47 0.21
48 0.22
49 0.24
50 0.21
51 0.17
52 0.16
53 0.16
54 0.18
55 0.17
56 0.14
57 0.16
58 0.22
59 0.28
60 0.33
61 0.42
62 0.49
63 0.59
64 0.69
65 0.77
66 0.8
67 0.85
68 0.9
69 0.9
70 0.86
71 0.84
72 0.82
73 0.78
74 0.76
75 0.67
76 0.63
77 0.55
78 0.52
79 0.49
80 0.42
81 0.37
82 0.33