Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y5K6

Protein Details
Accession A0A1Y1Y5K6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKGRKNTRKKATKKAETGELAHydrophilic
NLS Segment(s)
PositionSequence
4-14RKNTRKKATKK
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MKGRKNTRKKATKKAETGELATPGLLFPVEAVLEKMRSFSRMDVTLDAGIYITSMIQHVVEDILDEAVYKVHNAGTGRIIPKDINEIIKHDSEWSQLFKNVVIAQGGRCDLAAQNTNHCSTSNQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.74
4 0.68
5 0.6
6 0.51
7 0.41
8 0.32
9 0.26
10 0.17
11 0.14
12 0.1
13 0.06
14 0.04
15 0.04
16 0.05
17 0.05
18 0.07
19 0.07
20 0.09
21 0.09
22 0.11
23 0.1
24 0.12
25 0.13
26 0.13
27 0.16
28 0.17
29 0.19
30 0.18
31 0.19
32 0.18
33 0.17
34 0.15
35 0.11
36 0.08
37 0.06
38 0.05
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.07
60 0.07
61 0.08
62 0.1
63 0.14
64 0.15
65 0.15
66 0.16
67 0.14
68 0.14
69 0.18
70 0.18
71 0.18
72 0.17
73 0.2
74 0.22
75 0.22
76 0.22
77 0.19
78 0.18
79 0.17
80 0.19
81 0.19
82 0.18
83 0.19
84 0.2
85 0.18
86 0.21
87 0.19
88 0.18
89 0.16
90 0.15
91 0.14
92 0.17
93 0.17
94 0.14
95 0.13
96 0.13
97 0.12
98 0.17
99 0.23
100 0.21
101 0.27
102 0.31
103 0.33
104 0.32
105 0.32