Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZD76

Protein Details
Accession A0A1Y1ZD76   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
8-30YSKGRVLGFKRAKRNQRTNTSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 12.5, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MSQPVRLYSKGRVLGFKRAKRNQRTNTSLVQLENVSTKEDTQFYLGKRVAYVYRAKREINGSKVRVIWGRVTRPHGNSGVVKAKFRSNLPPHSFGASVRVMMYPSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.63
4 0.65
5 0.68
6 0.75
7 0.78
8 0.85
9 0.84
10 0.84
11 0.83
12 0.77
13 0.72
14 0.66
15 0.58
16 0.47
17 0.39
18 0.29
19 0.23
20 0.21
21 0.16
22 0.14
23 0.12
24 0.12
25 0.12
26 0.13
27 0.12
28 0.13
29 0.16
30 0.15
31 0.21
32 0.21
33 0.2
34 0.19
35 0.2
36 0.18
37 0.18
38 0.25
39 0.24
40 0.28
41 0.31
42 0.31
43 0.32
44 0.37
45 0.4
46 0.4
47 0.41
48 0.38
49 0.38
50 0.38
51 0.38
52 0.33
53 0.29
54 0.28
55 0.27
56 0.3
57 0.32
58 0.38
59 0.42
60 0.42
61 0.44
62 0.39
63 0.37
64 0.33
65 0.35
66 0.37
67 0.33
68 0.33
69 0.31
70 0.34
71 0.34
72 0.35
73 0.39
74 0.38
75 0.47
76 0.51
77 0.54
78 0.51
79 0.52
80 0.5
81 0.4
82 0.38
83 0.29
84 0.23
85 0.19
86 0.18
87 0.16