Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Z704

Protein Details
Accession A0A1Y1Z704   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
269-292FISGRYTRSTPRRHPPLLRSEPHFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7.5, cyto_nucl 7, mito 5, E.R. 4, nucl 3.5, pero 3, plas 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000014  PAS  
IPR035965  PAS-like_dom_sf  
IPR013655  PAS_fold_3  
Pfam View protein in Pfam  
PF08447  PAS_3  
PF13426  PAS_9  
PROSITE View protein in PROSITE  
PS50112  PAS  
CDD cd00130  PAS  
Amino Acid Sequences MIEPNFMLFLEYAPDATVLYVSANIAEVLGFKPDEVIGLKWDFLYHPDDKEGVKTVYHAALKEDKLFSVILCRARHKEGFYVYVEVIGVICHDMIVVFYSLITGPPRFKCQLIPYQRVALVERTRVLDQGLETMDSFNRPISLIKYPNVDAAFRNLTPEPRVCLVINRFTLRHAILFASNASESLLGIMPEEMIGVPLLSYILPEDMCTVDHAFFTIKSHESMTSFPVVFLSPRYGELNLHAVAISCSDGIILLLRPDNNRYTVNEEVFISGRYTRSTPRRHPPLLRSEPHFETIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.07
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.09
17 0.08
18 0.08
19 0.09
20 0.09
21 0.11
22 0.11
23 0.12
24 0.13
25 0.15
26 0.15
27 0.14
28 0.15
29 0.14
30 0.14
31 0.19
32 0.18
33 0.18
34 0.2
35 0.22
36 0.22
37 0.24
38 0.26
39 0.21
40 0.19
41 0.18
42 0.19
43 0.23
44 0.24
45 0.22
46 0.21
47 0.26
48 0.28
49 0.31
50 0.29
51 0.23
52 0.23
53 0.22
54 0.18
55 0.18
56 0.21
57 0.23
58 0.25
59 0.3
60 0.32
61 0.37
62 0.4
63 0.37
64 0.38
65 0.34
66 0.36
67 0.33
68 0.32
69 0.27
70 0.24
71 0.22
72 0.16
73 0.13
74 0.09
75 0.07
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.05
83 0.05
84 0.04
85 0.04
86 0.05
87 0.05
88 0.06
89 0.08
90 0.08
91 0.12
92 0.14
93 0.19
94 0.2
95 0.21
96 0.24
97 0.28
98 0.36
99 0.4
100 0.44
101 0.41
102 0.42
103 0.43
104 0.4
105 0.36
106 0.32
107 0.26
108 0.23
109 0.22
110 0.21
111 0.2
112 0.2
113 0.18
114 0.13
115 0.11
116 0.12
117 0.11
118 0.09
119 0.08
120 0.09
121 0.09
122 0.08
123 0.08
124 0.06
125 0.06
126 0.06
127 0.07
128 0.09
129 0.14
130 0.16
131 0.17
132 0.19
133 0.19
134 0.22
135 0.22
136 0.2
137 0.15
138 0.16
139 0.17
140 0.15
141 0.17
142 0.14
143 0.15
144 0.16
145 0.17
146 0.16
147 0.14
148 0.16
149 0.14
150 0.19
151 0.2
152 0.24
153 0.25
154 0.25
155 0.24
156 0.23
157 0.25
158 0.21
159 0.18
160 0.13
161 0.12
162 0.1
163 0.11
164 0.1
165 0.09
166 0.09
167 0.08
168 0.08
169 0.07
170 0.06
171 0.06
172 0.07
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.05
192 0.06
193 0.06
194 0.07
195 0.08
196 0.09
197 0.09
198 0.09
199 0.1
200 0.09
201 0.09
202 0.11
203 0.12
204 0.12
205 0.13
206 0.14
207 0.15
208 0.16
209 0.17
210 0.18
211 0.19
212 0.18
213 0.17
214 0.16
215 0.15
216 0.14
217 0.14
218 0.16
219 0.12
220 0.14
221 0.17
222 0.17
223 0.17
224 0.19
225 0.22
226 0.18
227 0.18
228 0.15
229 0.14
230 0.13
231 0.13
232 0.11
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.06
239 0.06
240 0.07
241 0.1
242 0.13
243 0.15
244 0.18
245 0.21
246 0.23
247 0.25
248 0.26
249 0.31
250 0.35
251 0.35
252 0.33
253 0.31
254 0.3
255 0.28
256 0.26
257 0.21
258 0.17
259 0.17
260 0.18
261 0.2
262 0.26
263 0.35
264 0.44
265 0.51
266 0.6
267 0.69
268 0.75
269 0.81
270 0.81
271 0.83
272 0.83
273 0.8
274 0.76
275 0.73
276 0.68