Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XXN5

Protein Details
Accession A0A1Y1XXN5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-49SSTNKVAIIKKRTKPFKRHQSDRYKTVKESWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-49KKRTKPFKRHQSDRYKTVKESWRKPKGIDNRVRRRFKG
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSSTNKVAIIKKRTKPFKRHQSDRYKTVKESWRKPKGIDNRVRRRFKGQIPMPKIGYGSNQKTRHLMPNGFKKFVVSSVKELEVLLMQNRTYAAEVAHNVSSKNRIAIVERAQQLNVKVTNANARLRTQEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.83
4 0.86
5 0.87
6 0.88
7 0.89
8 0.9
9 0.9
10 0.89
11 0.88
12 0.86
13 0.79
14 0.71
15 0.7
16 0.68
17 0.66
18 0.69
19 0.7
20 0.71
21 0.68
22 0.68
23 0.69
24 0.7
25 0.71
26 0.71
27 0.71
28 0.72
29 0.8
30 0.84
31 0.77
32 0.73
33 0.7
34 0.67
35 0.67
36 0.63
37 0.63
38 0.63
39 0.65
40 0.58
41 0.52
42 0.45
43 0.35
44 0.32
45 0.29
46 0.29
47 0.34
48 0.35
49 0.35
50 0.37
51 0.38
52 0.4
53 0.37
54 0.36
55 0.34
56 0.42
57 0.45
58 0.44
59 0.42
60 0.36
61 0.32
62 0.32
63 0.31
64 0.23
65 0.22
66 0.24
67 0.24
68 0.24
69 0.23
70 0.18
71 0.14
72 0.13
73 0.11
74 0.09
75 0.09
76 0.09
77 0.09
78 0.1
79 0.09
80 0.09
81 0.08
82 0.09
83 0.11
84 0.13
85 0.15
86 0.15
87 0.15
88 0.16
89 0.19
90 0.17
91 0.18
92 0.16
93 0.16
94 0.19
95 0.25
96 0.29
97 0.33
98 0.36
99 0.36
100 0.35
101 0.36
102 0.35
103 0.35
104 0.3
105 0.24
106 0.22
107 0.23
108 0.3
109 0.33
110 0.37
111 0.34
112 0.34