Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Z7U4

Protein Details
Accession A0A1Y1Z7U4   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-59CDDFKVWTKKERKEEKKAKVASAHydrophilic
NLS Segment(s)
PositionSequence
46-54KERKEEKKA
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039799  ALR/ERV  
IPR036774  ERV/ALR_sulphydryl_oxid_sf  
IPR017905  ERV/ALR_sulphydryl_oxidase  
Gene Ontology GO:0016971  F:flavin-linked sulfhydryl oxidase activity  
Pfam View protein in Pfam  
PF04777  Evr1_Alr  
PROSITE View protein in PROSITE  
PS51324  ERV_ALR  
Amino Acid Sequences MSPSIQAEEPSSSSPIPEPLPSKPVGKEKAKKPCRVCDDFKVWTKKERKEEKKAKVASAETDKVNVVHSDTKESPKPVECPPDSQQLGRATWTFLHTMAAYYPDNPDKEQQSNMKTLIKSFSKFYPCGYCASHLQEELKKNEPKVDSRSALSRWMCDIHNEVNERLGKPIFDCSKTDERWRDGPKDGSCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.22
5 0.23
6 0.24
7 0.28
8 0.29
9 0.31
10 0.33
11 0.4
12 0.44
13 0.51
14 0.56
15 0.61
16 0.7
17 0.76
18 0.79
19 0.77
20 0.79
21 0.78
22 0.77
23 0.74
24 0.72
25 0.7
26 0.68
27 0.7
28 0.69
29 0.62
30 0.63
31 0.65
32 0.65
33 0.67
34 0.72
35 0.72
36 0.75
37 0.84
38 0.84
39 0.85
40 0.81
41 0.73
42 0.68
43 0.6
44 0.54
45 0.5
46 0.44
47 0.34
48 0.31
49 0.29
50 0.23
51 0.23
52 0.17
53 0.13
54 0.15
55 0.15
56 0.2
57 0.21
58 0.25
59 0.27
60 0.28
61 0.28
62 0.26
63 0.29
64 0.27
65 0.33
66 0.3
67 0.33
68 0.34
69 0.41
70 0.39
71 0.36
72 0.37
73 0.32
74 0.31
75 0.26
76 0.24
77 0.16
78 0.16
79 0.17
80 0.12
81 0.09
82 0.1
83 0.09
84 0.09
85 0.08
86 0.1
87 0.09
88 0.08
89 0.1
90 0.12
91 0.13
92 0.14
93 0.17
94 0.17
95 0.19
96 0.23
97 0.26
98 0.26
99 0.28
100 0.29
101 0.3
102 0.27
103 0.26
104 0.28
105 0.26
106 0.25
107 0.24
108 0.28
109 0.29
110 0.29
111 0.3
112 0.31
113 0.29
114 0.31
115 0.3
116 0.27
117 0.26
118 0.31
119 0.3
120 0.25
121 0.27
122 0.29
123 0.33
124 0.34
125 0.39
126 0.37
127 0.36
128 0.41
129 0.4
130 0.41
131 0.42
132 0.46
133 0.4
134 0.39
135 0.43
136 0.39
137 0.43
138 0.39
139 0.34
140 0.29
141 0.29
142 0.27
143 0.25
144 0.28
145 0.25
146 0.29
147 0.31
148 0.29
149 0.32
150 0.35
151 0.33
152 0.32
153 0.28
154 0.23
155 0.21
156 0.3
157 0.29
158 0.29
159 0.3
160 0.34
161 0.42
162 0.45
163 0.54
164 0.52
165 0.52
166 0.59
167 0.64
168 0.62
169 0.6
170 0.65