Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZA46

Protein Details
Accession A0A1Y1ZA46    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-34VSLPGVNSKKRPRRRFDEIERLYHydrophilic
NLS Segment(s)
PositionSequence
21-24KRPR
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences SNDDSQKEFSFVSLPGVNSKKRPRRRFDEIERLYACSWPGCSKSYGTLNHLNAHVTMQKHGSKRQPSEFKELRKYWKQQKQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.27
4 0.29
5 0.35
6 0.45
7 0.5
8 0.59
9 0.67
10 0.69
11 0.73
12 0.8
13 0.83
14 0.82
15 0.83
16 0.75
17 0.74
18 0.66
19 0.59
20 0.5
21 0.4
22 0.31
23 0.2
24 0.18
25 0.12
26 0.13
27 0.12
28 0.13
29 0.13
30 0.16
31 0.21
32 0.21
33 0.24
34 0.29
35 0.3
36 0.31
37 0.3
38 0.28
39 0.23
40 0.22
41 0.21
42 0.15
43 0.15
44 0.17
45 0.22
46 0.25
47 0.31
48 0.38
49 0.43
50 0.49
51 0.58
52 0.63
53 0.63
54 0.7
55 0.71
56 0.71
57 0.72
58 0.72
59 0.71
60 0.71
61 0.75
62 0.76