Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YPG4

Protein Details
Accession A0A1Y1YPG4   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23SWEDYFKLRRSRRIRERISSIPTHydrophilic
125-146KSVSDYRSWLRKQREHRRKATFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8mito 8mito_nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013875  Pam17  
Gene Ontology GO:0001405  C:PAM complex, Tim23 associated import motor  
GO:0030150  P:protein import into mitochondrial matrix  
Pfam View protein in Pfam  
PF08566  Pam17  
Amino Acid Sequences SWEDYFKLRRSRRIRERISSIPTTIAGVGLSSAYFASLEVDPTLTYFGMDPLLVYGAGVVASGFGGFLVGPLFGNGLWSLFNRNLANKINIRDRQFYERIKKHRSDPSLNSFRNPVPDFYGEKIKSVSDYRSWLRKQREHRRKATF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.83
4 0.81
5 0.79
6 0.72
7 0.62
8 0.52
9 0.44
10 0.36
11 0.28
12 0.2
13 0.13
14 0.09
15 0.08
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.06
24 0.06
25 0.07
26 0.07
27 0.08
28 0.07
29 0.08
30 0.09
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.07
67 0.07
68 0.11
69 0.11
70 0.12
71 0.16
72 0.18
73 0.22
74 0.22
75 0.26
76 0.31
77 0.36
78 0.39
79 0.4
80 0.41
81 0.44
82 0.46
83 0.5
84 0.52
85 0.55
86 0.59
87 0.62
88 0.62
89 0.63
90 0.66
91 0.66
92 0.64
93 0.63
94 0.66
95 0.69
96 0.66
97 0.6
98 0.54
99 0.48
100 0.48
101 0.42
102 0.34
103 0.28
104 0.31
105 0.33
106 0.32
107 0.41
108 0.33
109 0.33
110 0.32
111 0.28
112 0.28
113 0.28
114 0.29
115 0.23
116 0.29
117 0.33
118 0.42
119 0.47
120 0.52
121 0.59
122 0.63
123 0.7
124 0.76
125 0.81
126 0.82