Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PEY6

Protein Details
Accession B8PEY6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-102IHPRKPHAPTRRPRLKARRARWFGBasic
NLS Segment(s)
PositionSequence
81-99PRKPHAPTRRPRLKARRAR
Subcellular Location(s) mito 18, cyto 4, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001260  Coprogen_oxidase_aer  
IPR036406  Coprogen_oxidase_aer_sf  
Gene Ontology GO:0004109  F:coproporphyrinogen oxidase activity  
GO:0006782  P:protoporphyrinogen IX biosynthetic process  
KEGG ppl:POSPLDRAFT_98029  -  
Pfam View protein in Pfam  
PF01218  Coprogen_oxidas  
Amino Acid Sequences MRQQGGRGLSCVFAVPHPSTSEAAAAAQNTVLEKAGVNISVVHGTLPQAAVKQMRADHGSMASLEGSLPFFAAGISLVIHPRKPHAPTRRPRLKARRARWFGGGSDLTPSYLYEKDARHFYATLMDACAPHGSAIYPTFKIWLAASGESSSTISASLGEAFVPSYLPIIERRMPSDEHARRWRLLRRGRYVEFNLVYDRGTRFGMLTPGVRIESVLMSLLETERWDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.2
5 0.22
6 0.22
7 0.22
8 0.21
9 0.16
10 0.15
11 0.15
12 0.13
13 0.11
14 0.1
15 0.1
16 0.1
17 0.1
18 0.09
19 0.07
20 0.07
21 0.08
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.1
28 0.1
29 0.09
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.11
37 0.13
38 0.13
39 0.16
40 0.16
41 0.19
42 0.21
43 0.21
44 0.2
45 0.18
46 0.18
47 0.15
48 0.14
49 0.1
50 0.08
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.05
64 0.08
65 0.08
66 0.1
67 0.1
68 0.13
69 0.18
70 0.21
71 0.29
72 0.38
73 0.47
74 0.55
75 0.66
76 0.73
77 0.73
78 0.8
79 0.82
80 0.82
81 0.82
82 0.82
83 0.82
84 0.77
85 0.74
86 0.69
87 0.6
88 0.5
89 0.44
90 0.36
91 0.25
92 0.21
93 0.19
94 0.14
95 0.12
96 0.12
97 0.09
98 0.09
99 0.1
100 0.12
101 0.13
102 0.15
103 0.17
104 0.18
105 0.18
106 0.17
107 0.16
108 0.16
109 0.16
110 0.15
111 0.13
112 0.12
113 0.11
114 0.11
115 0.11
116 0.07
117 0.06
118 0.06
119 0.05
120 0.06
121 0.08
122 0.09
123 0.1
124 0.1
125 0.11
126 0.11
127 0.12
128 0.1
129 0.12
130 0.12
131 0.11
132 0.12
133 0.11
134 0.11
135 0.11
136 0.11
137 0.08
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.05
152 0.05
153 0.06
154 0.08
155 0.12
156 0.17
157 0.18
158 0.21
159 0.23
160 0.24
161 0.27
162 0.37
163 0.38
164 0.42
165 0.5
166 0.5
167 0.51
168 0.56
169 0.6
170 0.59
171 0.63
172 0.64
173 0.65
174 0.7
175 0.7
176 0.71
177 0.68
178 0.67
179 0.59
180 0.51
181 0.44
182 0.36
183 0.33
184 0.28
185 0.25
186 0.18
187 0.17
188 0.16
189 0.14
190 0.16
191 0.18
192 0.18
193 0.18
194 0.18
195 0.19
196 0.19
197 0.18
198 0.16
199 0.15
200 0.13
201 0.12
202 0.12
203 0.09
204 0.09
205 0.1
206 0.1
207 0.1