Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YER4

Protein Details
Accession A0A1Y1YER4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-53LERNRKAALKCRQRKKQWLNNLQIKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences FSRRSSVDEVESKVKPDMTPEEKRKLFLERNRKAALKCRQRKKQWLNNLQIKVDYLSQENESLQTQATCLREEIINLKTLLLAHKDCPVAQANGVIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.26
3 0.26
4 0.31
5 0.32
6 0.42
7 0.46
8 0.54
9 0.53
10 0.55
11 0.52
12 0.52
13 0.53
14 0.51
15 0.56
16 0.52
17 0.58
18 0.6
19 0.61
20 0.55
21 0.56
22 0.58
23 0.57
24 0.61
25 0.65
26 0.71
27 0.76
28 0.85
29 0.85
30 0.85
31 0.84
32 0.84
33 0.83
34 0.82
35 0.76
36 0.65
37 0.55
38 0.46
39 0.36
40 0.27
41 0.19
42 0.12
43 0.11
44 0.11
45 0.12
46 0.11
47 0.12
48 0.11
49 0.11
50 0.1
51 0.08
52 0.08
53 0.11
54 0.12
55 0.12
56 0.12
57 0.13
58 0.12
59 0.14
60 0.17
61 0.15
62 0.16
63 0.16
64 0.16
65 0.15
66 0.15
67 0.17
68 0.18
69 0.18
70 0.17
71 0.22
72 0.23
73 0.22
74 0.25
75 0.26
76 0.23
77 0.22