Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PCR0

Protein Details
Accession B8PCR0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-117RPAWRVVNKREERRQKAKAKALPHydrophilic
NLS Segment(s)
PositionSequence
99-119RVVNKREERRQKAKAKALPPP
Subcellular Location(s) mito 19.5, cyto_mito 12, nucl 4
Family & Domain DBs
KEGG ppl:POSPLDRAFT_92804  -  
ppl:POSPLDRAFT_96341  -  
Amino Acid Sequences MSSKGSGGAPPKYLNDFSKALAGEVRILLQEVGKLRDERRALQYEIAELMALKSKHGAGGEYTPDWKPTHDEPAPPPSPGPPPPPASVVGDAPARPAWRVVNKREERRQKAKAKALPPPEPIPQPEPTRAPNLPAWAQWRRPPTPPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.31
4 0.29
5 0.31
6 0.29
7 0.24
8 0.22
9 0.2
10 0.17
11 0.15
12 0.15
13 0.1
14 0.1
15 0.1
16 0.09
17 0.11
18 0.11
19 0.13
20 0.16
21 0.18
22 0.18
23 0.25
24 0.27
25 0.28
26 0.33
27 0.36
28 0.34
29 0.35
30 0.35
31 0.29
32 0.27
33 0.23
34 0.16
35 0.11
36 0.1
37 0.11
38 0.1
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.11
45 0.08
46 0.11
47 0.13
48 0.13
49 0.15
50 0.14
51 0.16
52 0.16
53 0.14
54 0.16
55 0.15
56 0.23
57 0.22
58 0.24
59 0.25
60 0.33
61 0.33
62 0.3
63 0.28
64 0.22
65 0.25
66 0.25
67 0.27
68 0.23
69 0.25
70 0.26
71 0.28
72 0.28
73 0.26
74 0.25
75 0.2
76 0.18
77 0.16
78 0.14
79 0.14
80 0.14
81 0.12
82 0.11
83 0.12
84 0.14
85 0.22
86 0.28
87 0.32
88 0.42
89 0.5
90 0.59
91 0.67
92 0.74
93 0.74
94 0.77
95 0.82
96 0.8
97 0.82
98 0.82
99 0.8
100 0.75
101 0.74
102 0.73
103 0.7
104 0.66
105 0.61
106 0.56
107 0.52
108 0.5
109 0.46
110 0.44
111 0.42
112 0.42
113 0.42
114 0.4
115 0.44
116 0.41
117 0.41
118 0.38
119 0.39
120 0.36
121 0.36
122 0.4
123 0.4
124 0.45
125 0.47
126 0.52
127 0.5
128 0.54