Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P8Y7

Protein Details
Accession B8P8Y7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SASIAKTKSQKGKPTPPTTQEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027235  PFD2  
IPR002777  PFD_beta-like  
IPR009053  Prefoldin  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
KEGG ppl:POSPLDRAFT_87383  -  
Pfam View protein in Pfam  
PF01920  Prefoldin_2  
Amino Acid Sequences MSASIAKTKSQKGKPTPPTTQEIQQNYNRLQNELQTLASKIGELEQEAEEHGLVLATLDEALTEEPDRKCFRLVGGVLVERTVKDVVPALQTNKEGILKVVANLAEQYKSKEEELESFKRDYNIRPASAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.81
4 0.76
5 0.74
6 0.68
7 0.65
8 0.63
9 0.58
10 0.55
11 0.52
12 0.52
13 0.49
14 0.51
15 0.45
16 0.39
17 0.34
18 0.31
19 0.3
20 0.25
21 0.24
22 0.19
23 0.19
24 0.18
25 0.17
26 0.14
27 0.1
28 0.1
29 0.09
30 0.08
31 0.09
32 0.08
33 0.09
34 0.09
35 0.09
36 0.07
37 0.07
38 0.06
39 0.04
40 0.03
41 0.03
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.03
49 0.04
50 0.04
51 0.08
52 0.08
53 0.12
54 0.14
55 0.14
56 0.15
57 0.15
58 0.15
59 0.18
60 0.18
61 0.17
62 0.18
63 0.18
64 0.17
65 0.17
66 0.17
67 0.1
68 0.12
69 0.1
70 0.07
71 0.07
72 0.08
73 0.09
74 0.13
75 0.15
76 0.16
77 0.18
78 0.19
79 0.19
80 0.2
81 0.19
82 0.16
83 0.14
84 0.15
85 0.13
86 0.13
87 0.15
88 0.13
89 0.12
90 0.13
91 0.14
92 0.14
93 0.14
94 0.17
95 0.18
96 0.2
97 0.2
98 0.22
99 0.22
100 0.27
101 0.34
102 0.36
103 0.37
104 0.36
105 0.38
106 0.39
107 0.4
108 0.38
109 0.41
110 0.41