Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XNU3

Protein Details
Accession A0A1Y1XNU3    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-44TERPYNQAPRPNDKRPRRKIDKSAIGKPSNHydrophilic
NLS Segment(s)
PositionSequence
27-36DKRPRRKIDK
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
IPR039056  SPEC  
Gene Ontology GO:0005856  C:cytoskeleton  
GO:0005886  C:plasma membrane  
GO:0031267  F:small GTPase binding  
GO:0008360  P:regulation of cell shape  
GO:0035023  P:regulation of Rho protein signal transduction  
PROSITE View protein in PROSITE  
PS50108  CRIB  
CDD cd00132  CRIB  
Amino Acid Sequences MCNCFGVDDDDVLLTERPYNQAPRPNDKRPRRKIDKSAIGKPSNFQHTGHIGIGEIRNGIVDRVDPEKIKKQMAEIAAVLNFDDTAGHSTNLTPTNKASEAKMSRSMDQAAEKDKSRQEMALSKDPSDYQTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.13
5 0.17
6 0.22
7 0.26
8 0.34
9 0.4
10 0.48
11 0.56
12 0.63
13 0.7
14 0.76
15 0.82
16 0.84
17 0.88
18 0.88
19 0.89
20 0.89
21 0.89
22 0.88
23 0.85
24 0.83
25 0.81
26 0.74
27 0.65
28 0.57
29 0.52
30 0.48
31 0.42
32 0.33
33 0.28
34 0.27
35 0.29
36 0.27
37 0.21
38 0.15
39 0.16
40 0.15
41 0.12
42 0.09
43 0.06
44 0.06
45 0.06
46 0.06
47 0.04
48 0.04
49 0.06
50 0.08
51 0.1
52 0.1
53 0.13
54 0.2
55 0.22
56 0.23
57 0.22
58 0.21
59 0.24
60 0.24
61 0.23
62 0.17
63 0.15
64 0.14
65 0.14
66 0.12
67 0.08
68 0.06
69 0.05
70 0.04
71 0.04
72 0.06
73 0.07
74 0.08
75 0.08
76 0.09
77 0.12
78 0.18
79 0.18
80 0.16
81 0.16
82 0.21
83 0.23
84 0.24
85 0.22
86 0.26
87 0.28
88 0.31
89 0.39
90 0.37
91 0.36
92 0.38
93 0.38
94 0.32
95 0.33
96 0.32
97 0.29
98 0.3
99 0.3
100 0.33
101 0.35
102 0.36
103 0.34
104 0.33
105 0.32
106 0.35
107 0.41
108 0.45
109 0.44
110 0.4
111 0.41
112 0.4
113 0.38