Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XUU2

Protein Details
Accession A0A1Y1XUU2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-57QQPVAKTKVSKPRVKRKASKAEVLHydrophilic
NLS Segment(s)
PositionSequence
41-52KVSKPRVKRKAS
Subcellular Location(s) mito 19, cyto_mito 13.333, cyto 5.5, cyto_nucl 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR010285  DNA_helicase_pif1-like  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003678  F:DNA helicase activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF05970  PIF1  
Amino Acid Sequences MFLLPHRFRQPLWQLLSVTDRVLERRIHTGALLQQPVAKTKVSKPRVKRKASKAEVLAVEEPPLPKIEAPLEPVTLSVEQKNSIREALTGCNVFLTGSAGVGKSFLLRYLIEKLREEGKNVAVTAPTGIAAFHIGGHTVHHFAGLPVRNHGWETTLWNVGLYCSLDKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.49
4 0.4
5 0.32
6 0.26
7 0.21
8 0.19
9 0.22
10 0.22
11 0.2
12 0.25
13 0.26
14 0.24
15 0.23
16 0.25
17 0.27
18 0.31
19 0.29
20 0.24
21 0.25
22 0.25
23 0.28
24 0.26
25 0.21
26 0.17
27 0.24
28 0.34
29 0.4
30 0.48
31 0.55
32 0.65
33 0.74
34 0.81
35 0.82
36 0.82
37 0.85
38 0.82
39 0.79
40 0.7
41 0.66
42 0.58
43 0.51
44 0.42
45 0.31
46 0.27
47 0.21
48 0.18
49 0.13
50 0.13
51 0.1
52 0.08
53 0.09
54 0.11
55 0.11
56 0.15
57 0.15
58 0.15
59 0.14
60 0.14
61 0.15
62 0.13
63 0.13
64 0.1
65 0.09
66 0.1
67 0.12
68 0.13
69 0.12
70 0.11
71 0.11
72 0.1
73 0.11
74 0.11
75 0.12
76 0.11
77 0.1
78 0.1
79 0.1
80 0.09
81 0.07
82 0.07
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.07
94 0.07
95 0.09
96 0.16
97 0.2
98 0.22
99 0.23
100 0.24
101 0.3
102 0.31
103 0.31
104 0.27
105 0.26
106 0.26
107 0.25
108 0.24
109 0.16
110 0.16
111 0.14
112 0.11
113 0.08
114 0.06
115 0.06
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.08
124 0.1
125 0.1
126 0.1
127 0.1
128 0.1
129 0.1
130 0.17
131 0.21
132 0.21
133 0.24
134 0.25
135 0.26
136 0.27
137 0.27
138 0.22
139 0.18
140 0.22
141 0.22
142 0.23
143 0.22
144 0.21
145 0.21
146 0.19
147 0.2
148 0.17