Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZB09

Protein Details
Accession A0A1Y1ZB09    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MGRLRRSRTHRGIRDISRKYRTRRRTKDLDQIHEDBasic
NLS Segment(s)
PositionSequence
5-25RRSRTHRGIRDISRKYRTRRR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHRGIRDISRKYRTRRRTKDLDQIHEDLKTENTEKLLATQKGDADLPGLGEHYCIQCSRHFISGSALSEHYRGKLHKKRVKLLKEEPYTQKEAEAAAGLTTDNGKRTEKDMKDVNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.8
5 0.79
6 0.79
7 0.81
8 0.82
9 0.82
10 0.84
11 0.84
12 0.85
13 0.85
14 0.86
15 0.84
16 0.81
17 0.76
18 0.69
19 0.61
20 0.51
21 0.44
22 0.34
23 0.26
24 0.21
25 0.17
26 0.15
27 0.14
28 0.14
29 0.13
30 0.16
31 0.22
32 0.2
33 0.2
34 0.2
35 0.2
36 0.2
37 0.2
38 0.16
39 0.1
40 0.09
41 0.08
42 0.06
43 0.07
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.07
50 0.08
51 0.09
52 0.13
53 0.15
54 0.17
55 0.17
56 0.17
57 0.2
58 0.23
59 0.22
60 0.2
61 0.19
62 0.16
63 0.17
64 0.17
65 0.15
66 0.14
67 0.15
68 0.24
69 0.32
70 0.42
71 0.46
72 0.53
73 0.61
74 0.68
75 0.74
76 0.73
77 0.74
78 0.74
79 0.74
80 0.74
81 0.71
82 0.67
83 0.63
84 0.54
85 0.45
86 0.35
87 0.3
88 0.24
89 0.18
90 0.12
91 0.08
92 0.08
93 0.08
94 0.07
95 0.09
96 0.1
97 0.11
98 0.14
99 0.16
100 0.18
101 0.23
102 0.33
103 0.34
104 0.4