Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YV04

Protein Details
Accession A0A1Y1YV04    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
202-224DVPKLKNLKTRIQNRPKIKQYLEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_mito 11, nucl 4, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010987  Glutathione-S-Trfase_C-like  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR040079  Glutathione_S-Trfase  
IPR004046  GST_C  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF14497  GST_C_3  
PROSITE View protein in PROSITE  
PS50405  GST_CTER  
CDD cd03192  GST_C_Sigma_like  
cd03039  GST_N_Sigma_like  
Amino Acid Sequences MSDTWELYYWPGMPGRGEFMRLLFIETSTPFKDVYAGEDWTAVGKVNYQLSKEFFALPTIKHNGFMLSQTPVICRYLAVKLNNGVLYPKEELLGYQAEMIMAGIVDLTAEGHDAWHPIDKNATYVSQKEQAKPFIEYYEKKRLPKWFSFFEKVLAENEKKYPSFDEGGPFLVGESISYVDLCMFHILDGIEFQCPEAYAFIDVPKLKNLKTRIQNRPKIKQYLESAQRSRFTGTGPIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.21
4 0.22
5 0.2
6 0.19
7 0.22
8 0.21
9 0.22
10 0.17
11 0.16
12 0.16
13 0.17
14 0.21
15 0.18
16 0.19
17 0.16
18 0.16
19 0.18
20 0.16
21 0.19
22 0.18
23 0.18
24 0.17
25 0.17
26 0.17
27 0.16
28 0.16
29 0.11
30 0.08
31 0.09
32 0.11
33 0.16
34 0.18
35 0.18
36 0.21
37 0.23
38 0.26
39 0.25
40 0.24
41 0.19
42 0.21
43 0.21
44 0.19
45 0.23
46 0.26
47 0.25
48 0.24
49 0.24
50 0.22
51 0.2
52 0.21
53 0.17
54 0.13
55 0.15
56 0.14
57 0.15
58 0.15
59 0.15
60 0.13
61 0.12
62 0.12
63 0.15
64 0.21
65 0.21
66 0.22
67 0.23
68 0.26
69 0.26
70 0.23
71 0.19
72 0.14
73 0.16
74 0.15
75 0.13
76 0.11
77 0.1
78 0.1
79 0.11
80 0.11
81 0.09
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.04
88 0.03
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.03
99 0.03
100 0.04
101 0.05
102 0.08
103 0.08
104 0.08
105 0.1
106 0.1
107 0.11
108 0.11
109 0.13
110 0.11
111 0.12
112 0.15
113 0.2
114 0.22
115 0.24
116 0.27
117 0.29
118 0.29
119 0.3
120 0.28
121 0.24
122 0.27
123 0.27
124 0.3
125 0.37
126 0.4
127 0.39
128 0.43
129 0.49
130 0.51
131 0.55
132 0.54
133 0.51
134 0.54
135 0.57
136 0.53
137 0.48
138 0.43
139 0.36
140 0.33
141 0.3
142 0.25
143 0.22
144 0.25
145 0.25
146 0.23
147 0.24
148 0.24
149 0.22
150 0.23
151 0.22
152 0.22
153 0.2
154 0.21
155 0.2
156 0.18
157 0.14
158 0.11
159 0.1
160 0.07
161 0.06
162 0.05
163 0.06
164 0.06
165 0.06
166 0.05
167 0.06
168 0.07
169 0.07
170 0.06
171 0.06
172 0.08
173 0.08
174 0.08
175 0.09
176 0.09
177 0.08
178 0.08
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.1
187 0.1
188 0.15
189 0.16
190 0.17
191 0.23
192 0.25
193 0.25
194 0.31
195 0.36
196 0.41
197 0.49
198 0.58
199 0.63
200 0.72
201 0.8
202 0.82
203 0.87
204 0.87
205 0.86
206 0.79
207 0.76
208 0.72
209 0.73
210 0.73
211 0.72
212 0.69
213 0.66
214 0.65
215 0.59
216 0.55
217 0.45
218 0.38