Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y2P2

Protein Details
Accession A0A1Y1Y2P2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
106-126LWFRHAHKCHVHHKPKSLKKHBasic
NLS Segment(s)
Subcellular Location(s) cyto_mito 8.166, mito 8, cyto 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR028012  Rua1_C  
Pfam View protein in Pfam  
PF14616  Rua1_C  
Amino Acid Sequences MGDPDARPRQQKARFEGDLYTPQWVRYNGQAKEGFCQHCKPGKWLQLKNSAYWYHVQFYHGISATSGRYYRAPLQMSTFENGIRGLCHQCREVVAVCHTKKKDMALWFRHAHKCHVHHKPKSLKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.56
4 0.51
5 0.48
6 0.41
7 0.39
8 0.3
9 0.29
10 0.31
11 0.29
12 0.27
13 0.29
14 0.37
15 0.33
16 0.4
17 0.42
18 0.39
19 0.42
20 0.46
21 0.41
22 0.34
23 0.36
24 0.34
25 0.37
26 0.38
27 0.39
28 0.4
29 0.46
30 0.52
31 0.54
32 0.55
33 0.59
34 0.58
35 0.55
36 0.52
37 0.44
38 0.36
39 0.34
40 0.3
41 0.21
42 0.21
43 0.2
44 0.16
45 0.16
46 0.17
47 0.14
48 0.12
49 0.1
50 0.11
51 0.1
52 0.11
53 0.1
54 0.08
55 0.09
56 0.11
57 0.15
58 0.19
59 0.2
60 0.2
61 0.23
62 0.26
63 0.26
64 0.25
65 0.22
66 0.17
67 0.16
68 0.15
69 0.12
70 0.09
71 0.1
72 0.13
73 0.15
74 0.17
75 0.17
76 0.18
77 0.19
78 0.21
79 0.21
80 0.19
81 0.23
82 0.29
83 0.3
84 0.38
85 0.38
86 0.38
87 0.37
88 0.38
89 0.39
90 0.39
91 0.47
92 0.46
93 0.53
94 0.56
95 0.61
96 0.66
97 0.61
98 0.59
99 0.58
100 0.58
101 0.61
102 0.67
103 0.69
104 0.69
105 0.78
106 0.82