Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HCA9

Protein Details
Accession A0A1Y2HCA9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSKNHTNHNQNKKAHRNGIKKHydrophilic
NLS Segment(s)
PositionSequence
14-49KKAHRNGIKKVATHRVRSMKGVDPKFRRNQKFAKKG
Subcellular Location(s) nucl 16.5, mito_nucl 11.5, mito 5.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKVATHRVRSMKGVDPKFRRNQKFAKKGTLVRRHVVLADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.77
7 0.8
8 0.74
9 0.67
10 0.64
11 0.64
12 0.59
13 0.54
14 0.54
15 0.51
16 0.48
17 0.47
18 0.45
19 0.42
20 0.45
21 0.47
22 0.48
23 0.47
24 0.53
25 0.61
26 0.67
27 0.66
28 0.64
29 0.69
30 0.72
31 0.76
32 0.73
33 0.74
34 0.71
35 0.73
36 0.77
37 0.77
38 0.72
39 0.66
40 0.63
41 0.55