Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HSP5

Protein Details
Accession A0A1Y2HSP5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
91-116SRPVKLRKSTWQERNIEKKKEKLAKIHydrophilic
NLS Segment(s)
PositionSequence
105-118NIEKKKEKLAKIFK
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR034215  RBM42_RRM  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12383  RRM_RBM42  
Amino Acid Sequences MIRYAAGQVWEDKSLIEWPDNDYRLFVGDLGPEVMTQTLEQAFGKYASFQKAHVVRDQRTGKSKGYGFVSFMNGEDFVKAFQEYNNKYLGSRPVKLRKSTWQERNIEKKKEKLAKIFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.15
5 0.19
6 0.26
7 0.28
8 0.26
9 0.23
10 0.22
11 0.22
12 0.21
13 0.16
14 0.1
15 0.09
16 0.09
17 0.09
18 0.09
19 0.07
20 0.07
21 0.07
22 0.07
23 0.06
24 0.07
25 0.06
26 0.07
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.09
33 0.11
34 0.14
35 0.14
36 0.14
37 0.2
38 0.23
39 0.25
40 0.28
41 0.31
42 0.29
43 0.38
44 0.41
45 0.37
46 0.39
47 0.41
48 0.37
49 0.36
50 0.36
51 0.3
52 0.3
53 0.28
54 0.23
55 0.22
56 0.23
57 0.18
58 0.18
59 0.15
60 0.12
61 0.11
62 0.1
63 0.08
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.17
70 0.19
71 0.21
72 0.23
73 0.23
74 0.23
75 0.26
76 0.33
77 0.31
78 0.33
79 0.41
80 0.48
81 0.55
82 0.59
83 0.6
84 0.61
85 0.65
86 0.7
87 0.71
88 0.7
89 0.71
90 0.76
91 0.83
92 0.82
93 0.82
94 0.78
95 0.77
96 0.78
97 0.8
98 0.78