Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I373

Protein Details
Accession A0A1Y2I373    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-89KTGWRRKWSLAKYRFRVPRAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, extr 5, mito 4
Family & Domain DBs
Amino Acid Sequences MIIVIYIHACFVAPCISIPLHITCINRSAICPSFWFEGTLHQTSLTDHDCLWPNNDASKVLLACPVGSAKTGWRRKWSLAKYRFRVPRAHCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.11
4 0.12
5 0.14
6 0.14
7 0.16
8 0.19
9 0.2
10 0.18
11 0.21
12 0.22
13 0.2
14 0.19
15 0.21
16 0.19
17 0.19
18 0.19
19 0.19
20 0.19
21 0.19
22 0.2
23 0.15
24 0.19
25 0.23
26 0.23
27 0.2
28 0.18
29 0.18
30 0.16
31 0.19
32 0.15
33 0.11
34 0.09
35 0.12
36 0.14
37 0.15
38 0.16
39 0.15
40 0.15
41 0.16
42 0.17
43 0.15
44 0.13
45 0.15
46 0.13
47 0.11
48 0.13
49 0.11
50 0.1
51 0.1
52 0.1
53 0.08
54 0.09
55 0.09
56 0.14
57 0.24
58 0.32
59 0.35
60 0.42
61 0.46
62 0.53
63 0.63
64 0.66
65 0.67
66 0.7
67 0.76
68 0.74
69 0.8
70 0.81
71 0.74
72 0.74