Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HY81

Protein Details
Accession A0A1Y2HY81    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-101TTTTNRTTRARKRKTSTMSTAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, plas 4, mito 3
Family & Domain DBs
Amino Acid Sequences MLKCVWICTYLLKICVFLANAHALGQIDCGAASMPSCNHAPTAHSGSLDRSNHLHGLNLTSQYHIASNLPQCHSRSAPTITTTTNRTTRARKRKTSTMSTAGTAALVVGSLGRRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.22
4 0.15
5 0.16
6 0.15
7 0.15
8 0.14
9 0.14
10 0.12
11 0.11
12 0.11
13 0.09
14 0.07
15 0.06
16 0.06
17 0.06
18 0.05
19 0.05
20 0.06
21 0.05
22 0.08
23 0.08
24 0.09
25 0.09
26 0.1
27 0.11
28 0.15
29 0.2
30 0.19
31 0.19
32 0.19
33 0.21
34 0.27
35 0.26
36 0.23
37 0.18
38 0.19
39 0.2
40 0.2
41 0.18
42 0.12
43 0.14
44 0.14
45 0.15
46 0.13
47 0.12
48 0.12
49 0.11
50 0.11
51 0.09
52 0.08
53 0.09
54 0.13
55 0.17
56 0.19
57 0.21
58 0.22
59 0.25
60 0.26
61 0.24
62 0.24
63 0.24
64 0.24
65 0.23
66 0.24
67 0.23
68 0.25
69 0.26
70 0.27
71 0.28
72 0.3
73 0.33
74 0.41
75 0.49
76 0.58
77 0.65
78 0.69
79 0.73
80 0.79
81 0.82
82 0.81
83 0.78
84 0.75
85 0.68
86 0.59
87 0.52
88 0.42
89 0.34
90 0.24
91 0.17
92 0.09
93 0.06
94 0.04
95 0.05
96 0.05