Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I0M1

Protein Details
Accession A0A1Y2I0M1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-86RMPTNPGRPCRNCPKRLKWAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, plas 6, mito 3
Family & Domain DBs
Amino Acid Sequences MRLSTLFGTILVVLVAQMAQTAPVAVPATNSESPLNNKPPYWPACYDSLYPGEGCICTGFLDPRCFRMPTNPGRPCRNCPKRLKWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.05
11 0.06
12 0.06
13 0.07
14 0.08
15 0.14
16 0.14
17 0.15
18 0.15
19 0.16
20 0.2
21 0.25
22 0.29
23 0.25
24 0.25
25 0.26
26 0.31
27 0.32
28 0.33
29 0.29
30 0.26
31 0.28
32 0.3
33 0.28
34 0.24
35 0.22
36 0.18
37 0.16
38 0.14
39 0.11
40 0.09
41 0.09
42 0.07
43 0.06
44 0.06
45 0.07
46 0.11
47 0.13
48 0.21
49 0.21
50 0.25
51 0.28
52 0.29
53 0.29
54 0.34
55 0.39
56 0.42
57 0.52
58 0.56
59 0.6
60 0.69
61 0.74
62 0.73
63 0.76
64 0.77
65 0.76
66 0.78