Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HPW3

Protein Details
Accession A0A1Y2HPW3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-43KDSSNKKRIKVGKNKFKWVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 14, nucl 13.5, mito 13.5
Family & Domain DBs
Amino Acid Sequences MTSLVAAICNKLHSLRLLKCWGYKDSSNKKRIKVGKNKFKWVDWNVDEEWQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.3
4 0.34
5 0.35
6 0.37
7 0.39
8 0.37
9 0.34
10 0.35
11 0.39
12 0.45
13 0.52
14 0.58
15 0.6
16 0.6
17 0.64
18 0.69
19 0.69
20 0.69
21 0.72
22 0.74
23 0.77
24 0.84
25 0.79
26 0.73
27 0.72
28 0.65
29 0.64
30 0.55
31 0.53
32 0.44